KEGG   Monopterus albus (swamp eel): 109960379
Entry
109960379         CDS       T05607                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109960379
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109960379
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109960379
   04217 Necroptosis
    109960379
   04115 p53 signaling pathway
    109960379
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109960379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:malb04050]
    109960379
   04090 CD molecules [BR:malb04090]
    109960379
Cytokine receptors [BR:malb04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   109960379
CD molecules [BR:malb04090]
 Proteins
  109960379
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 109960379
NCBI-ProteinID: XP_020456100
LinkDB
Position
Unknown
AA seq 156 aa
MASESTRFTALCVISLASIFYLLSPAHGASSSQLEGKSHGHSLKGVFRSKRESVCIDGEY
EHEGNPCCLCGAGQSLVWHCSSKSRDDRVCQPCKSGTYRSTPNYETTCEVCTSCDKLNEN
KEVAERCTPAKNTKCKCKKGHYCETEICVVCHPCKQ
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcttccgaatcaaccagatttactgcgttgtgtgttatctccttggcttcgatcttc
tatctgctgtcaccagcgcatggcgcatcttcatcccagctggaggggaaaagccacggg
cattcacttaaaggagtattccgtagcaaaagagagagtgtgtgtatagatggggagtat
gagcatgaagggaacccctgctgtctgtgtggtgctggccagtcactggtgtggcactgc
agttctaaatcacgagatgaccgagtgtgccagccctgtaaaagcggaacgtaccgtagt
acccctaattacgagacgacctgtgaggtctgcacatcctgcgataaactcaatgagaat
aaagaggtggccgaacgctgtacccctgccaagaacactaagtgtaaatgtaaaaagggt
cactactgcgaaactgaaatctgtgtggtctgccatccttgtaaacag

DBGET integrated database retrieval system