KEGG   Monopterus albus (swamp eel): 109961575
Entry
109961575         CDS       T05607                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109961575
   04350 TGF-beta signaling pathway
    109961575
   04371 Apelin signaling pathway
    109961575
   04068 FoxO signaling pathway
    109961575
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109961575
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109961575
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 109961575
NCBI-ProteinID: XP_020458151
LinkDB
Position
Unknown
AA seq 510 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQFAFDLKC
DSVCVNPYHYERVVSPGIDLSGLTLTPSGPTSALMVKDEYDFDGQHSLPSIEGGHSIQTI
QHPPSSSCPAPSEPFVAPNLLPPAEASTSASTSSFPAIAAGSASASSTWSRNSTFTPNIP
HHTNGHLQHHPPMPHPTHYWPVHNELAFQPPISNHPAPDYWCSIAYFEMDVQVGETFKVP
SSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCL
SDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQA
AAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETP
CWIEIHLHRALQLLDEVLHTMPIADPQPLD
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtccatcaccaacacacccacaagcaatgatgcctgcctgagcattgtgcacagtctg
atgtgtcacagacagggcggtgagagcgagacttttgccaagcgggccatcgagagcctg
gtgaagaagctgaaggagaaaaaagatgagcttgactccctcatcacagctatcaccacc
aatggggcccaccccagcaagtgtgtgaccattcagaggacacttgatggacggctgcag
gtggcaggacgtaaaggcttccctcatgtaatctatgcccggctgtggcgctggcctgac
ctgcataagaatgaactgaagcacgtcaaatactgccagtttgcctttgacctgaagtgt
gacagtgtgtgtgtcaacccctatcactatgagagagtggtgtctcctggcatagactta
tcaggactgactctgaccccttctggacccacctcagcattgatggtaaaggatgagtat
gattttgatgggcagcacagtctaccctccattgagggagggcactccatccagaccatc
cagcaccctccatccagcagctgcccggccccctctgaaccatttgtggccccaaacctg
ctcccacctgctgaggcctccacctctgcctcaacatcatctttcccagccattgctgct
ggatcagccagtgccagctctacctggtctaggaacagcaccttcacccctaacataccc
caccacaccaatggtcacctacagcaccaccctcctatgccccatccaacacactactgg
ccagtgcataatgagcttgcctttcagccccctatatccaaccatccagcccctgactac
tggtgttctattgcctattttgagatggatgttcaagttggggaaacgtttaaagtgccc
tcgtcttgtcccattgtgaccgtggacggctatgtcgatccctcaggaggagacaggttc
tgtctgggccagctcagcaatgtgcatcgcactgaggctatcgaaagagcaaggcttcac
attggtaaaggggtccagctggagtgtaaaggtgagggagatgtgtgggtgcgatgcctc
agtgaccatgccgtgtttgtccaaagttactacctggacagagaggcagggcgtgcccct
ggagacgccgttcacaaaatctaccccagtgcttacattaaggtgtttgaccttcgtcag
tgccacagacagatgcaacagcaggctgcgacggctcaggcagctgcagcagcccaagca
gcagctgtggctgggaatatacctggacctggatcagtaggagggatagctccagccatt
agtctgtctgcagcggccggtatcggggtagatgacctccggaggctgtgtattctcagg
atgagctttgttaaaggctgggggcccgactacccccgccaaagcatcaaggagacgccc
tgctggatcgagatccacctgcacagagctcttcagttactggatgaggttctacacact
atgcctatagcagacccgcagcctctggactga

KEGG   Monopterus albus (swamp eel): 109970820
Entry
109970820         CDS       T05607                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109970820
   04350 TGF-beta signaling pathway
    109970820
   04371 Apelin signaling pathway
    109970820
   04068 FoxO signaling pathway
    109970820
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109970820
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109970820
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 109970820
NCBI-ProteinID: XP_020474309
LinkDB
Position
Unknown
AA seq 503 aa
MSITNTPTSNDACLSIVHSLMCHRQGGESESFAKRAIESLVKKLKEKKDELDSLITAITT
NGAHPSKCVTIQRTLDGRLQVAGRKGFPHVVYARLWRWPDLHKNELKHVKYCQYAFDLKC
DNVCVNPYHYERVVSPGIDLSGLTLSNSGPLLVKDEYDLDNQQSHSSSESHLQTIQHPPS
RPGPQETFSSPALLPPSEASSSASTSAFSTITAGPSNPTPSWSRNSSFTPTVPQHQNGHL
QHHPPMPHTGHYWPVTNEIAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSTCPIVT
VDGYVDPSGGDRFCLGQLSNVHRTENIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFV
QSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAEAAAAAQAAAVAGNI
PGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHL
HRALQLLDEVLHTMPIADPQPLD
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgtcaatcacgaacactcccacaagtaatgatgcctgcctgagcattgtgcatagcctg
atgtgccaccgtcagggtggagagagtgaaagctttgctaagcgagctattgaaagtctt
gtcaagaagctgaaggagaaaaaagatgagctggattcccttatcacagccattactacg
aatggagcgcatcccagcaagtgtgtaaccatacagcgaactttggatgggcgcctacag
gttgcgggacgtaaaggttttccccatgttgtctatgccagactgtggcggtggcctgat
ctacacaagaatgaattaaaacatgtcaaatattgccagtatgcctttgacctgaaatgt
gacaacgtctgtgtcaacccatatcactacgagagggtcgtttctccaggcattgactta
tcaggactgactctttccaattcaggcccactgctggtgaaagatgagtatgaccttgat
aaccagcaatctcactccagctctgaaagccacttgcagaccatccagcatccgccgtca
aggcctggtccacaggaaaccttcagcagccctgctctgctccccccatcagaggccagc
agttcagcttcaacctctgctttctctactatcactgctggaccctcaaatcctacaccc
agctggagcaggaacagcagcttcacccccacggtgcctcaacaccagaatgggcatcta
cagcatcatccacccatgcctcacacagggcattactggcctgttactaatgaaattgca
tttcagccccccatatccaatcaccctgctccagaatattggtgctccattgcatatttt
gagatggatgtccaggttggagagacatttaaggtgccatccacatgtccaattgtgact
gtggatggctatgtggatccatcaggaggggatcgcttctgcctgggccagctgagcaat
gtccacaggacagagaacattgagagagctaggctccacattgggaaaggtgtgcagttg
gagtgcaaaggtgaaggagatgtctgggtgcgctgtttgagtgatcatgcagtgtttgtg
cagagctattacctggatcgagaggctggacgtgcccctggagatgcagttcacaagatc
taccccagtgcttacatcaaggtgtttgacttgcgtcaatgccacaggcagatgcagcag
caggcagcaacagcagaggcagcagctgctgcccaggcagcagcagtggctggaaacatt
cctggacctggctctgtgggaggcatcgcccctgccatcagtttgtctgctgctgcgggc
attggggtggatgacctgcgcaggctgtgcatcctgcggatgagcttcgtgaagggctgg
gggcccgactacccaagacaaagcatcaaagagacgccctgttggattgagatccattta
caccgagctctacagctgctggatgaagttctgcacaccatgcccatagctgacccgcaa
cctcttgactga

KEGG   Monopterus albus (swamp eel): 109970860
Entry
109970860         CDS       T05607                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109970860
   04350 TGF-beta signaling pathway
    109970860
   04371 Apelin signaling pathway
    109970860
   04068 FoxO signaling pathway
    109970860
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109970860
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109970860
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 109970860
NCBI-ProteinID: XP_020474367
LinkDB
Position
Unknown
AA seq 535 aa
MSVLSPAPSSADACLSIVHSLMCHRQVGENEGFAKRAIESLVKKLKEKEDELDSLITAVT
TNGVHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKFCQFAFDLK
YDSVCVNPYHYERVSSPATTAPQPLIKDEFIQDCLQIDLPSRPDTYSQPRPVGMYPSMPL
SPPGNSTMTVAALSAGGSGGVGGEGPGFLQIAPPDNHGAQASPPPPTPTSPHQQSLEYSS
PPKTATWTGNSPFPYSPTGPQQSGRSHQQPPSHRHHHHTPSTHFWSQHHSTAPYPQPVSN
HPGPEFWCSISYFELDIQVGEMFKVQSSCPLVTVDGYVDPSGGDRFCLGQLSNVHRTAAS
HRARLHIGRGVLLECRGEGDVWMRCLSDHSVFVQSLYLDREAGRAPGDGVHKIYPGAYIK
VFDLRQCHRQMQQQAAAAQATTAVSAIPGPNGVGGIAPAVMCPALPAVACSSAGLGVDDL
RRLCIVRLSFVKGWGCDYPRQSIKDTPCWLEVHLHRALQLLDQVLHTMPQQDQAL
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgtcggtgctcagcccagccccaagcagcgccgacgcctgcctcagcattgtccacagc
ctcatgtgccaccggcaggtcggagagaatgagggctttgccaagcgggccattgagagc
ctagtgaagaagctgaaggagaaggaggacgagctcgactcgctcatcaccgctgtcacc
accaatggcgtccaccccagcaagtgcgtgaccatccagaggacactagatgggcggctg
caggttgcaggcaggaaaggattcccccatgtgatctacgcccgtctgtggcgttggcct
gacctgcataagaacgagctgaaacatgtcaagttctgccagtttgccttcgacctgaag
tacgacagtgtgtgtgtgaacccctatcactatgagagggtgtcgtcccccgctaccaca
gctcctcagcctctgataaaggacgagttcattcaggactgtctgcagatcgacctgccc
tcgcgacctgacacatacagccagccccgccctgtcggcatgtatcccagcatgcctctg
tctcccccaggcaacagcaccatgacggtggctgccctgtcagctggtggcagcgggggt
gttgggggcgaggggccaggcttccttcagattgccccacctgacaaccatggggctcaa
gcatcccccccccctcccacccccacctccccacaccagcagagccttgagtacagcagc
ccccccaaaactgccacctggacaggtaacagccccttcccctacagccccacaggacct
cagcagagtgggcggagccaccagcagcctccttctcatcgtcatcatcatcataccccg
agcactcacttttggtcacagcaccacagtacggctccgtatcctcagccagtgtccaac
cacccaggtccagagttctggtgctccatctcgtacttcgagctggacatccaggttggg
gagatgttcaaggtacagtccagctgtcctctggtgacggtggatgggtatgtggaccct
tcagggggggaccgtttctgtttgggacagcttagcaatgtccaccgcactgctgccagc
caccgtgccaggctccacatcggtcggggggttctgctggagtgtcgtggggagggggac
gtttggatgcgctgcctcagcgaccactctgtgtttgtccagagtttgtatctggaccga
gaggcgggcagagcacctggagacggtgtccataagatctaccccggggcctacatcaag
gtgtttgacctgcgtcagtgtcacagacagatgcagcagcaagcagcagcagctcaggcg
acgacggctgtcagtgcgattccggggccaaacggtgtgggagggattgccccggctgtc
atgtgtcctgctcttcctgcagtggcgtgctcgtccgcaggtctgggcgtggacgacctg
cgtagattgtgtattgtgcgtctgagctttgtcaaaggctggggctgtgactacccacga
cagagcatcaaggacaccccctgctggctggaggtccacctgcaccgggcgctgcagctg
ctcgaccaggtgctgcacacgatgccacagcaggaccaggcactctga

KEGG   Monopterus albus (swamp eel): 109974571
Entry
109974571         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mothers against decapentaplegic homolog 4-like
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb04371  Apelin signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109974571
   04350 TGF-beta signaling pathway
    109974571
   04371 Apelin signaling pathway
    109974571
   04068 FoxO signaling pathway
    109974571
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109974571
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109974571
SSDB
Motif
Pfam: MH2 MH1 DUF1955
Other DBs
NCBI-GeneID: 109974571
NCBI-ProteinID: XP_020480470
LinkDB
Position
Unknown
AA seq 607 aa
MWTDSELGHHDASELSGHALADQLNTSSIMLVNPPSSNDACLSIVHSLMCHRQGGENEGF
AKRAIESLVKKLKEKKDELDSLITAITTNGVHPSKCVTIQRTLDGRLQVAGRKGFPHVIY
ARLWRWPDLHKNELKHAKFCQYAFDLKYDNVCVNPYHYERVVSPGIVGLSLQNTAAPSGL
IKEEYIHDCIQMDLPPGMPLLDHQAALKLPPPDCYGQPLPRPQLSSKPHGPPPVTRYTNL
PVSPKVSGSGSILPLQGSHSDGCLQSTSPQAQVMPPAQRSPSPSQPPPQQQAAQQLSQPP
RPQQPSLPPPHSHGQNGYSNNKHSQSQAAFHIWTGSSTASYTPVGLQSNGRSHQQPSLHH
PNHHWSPHHCPTSFPPSVSNHPEFWCSISYFEMDVQVGEMFKVPSSCPVVTVDGYVDPSG
GDRFCLGQLSNVHRTDASERARLHIGKGVQLECRGEGDVWMRCMSDHAVFVQSYYLDREA
GRAPGDAVHKIYPGAYIKVFDLRQCHRQMQQQAATAQAAAGAQXPGPGSVGGIAPAVSLS
AAAGIGVDDLRRLCILRLSFVKGWGPDYPRQSIKHTPCWVEVHLHRALQLLDEVLHTMPL
ADPGPAN
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtggactgattcagagctgggacatcatgatgccagtgaactttctggtcacgcactg
gctgatcaacttaacaccagcagcatcatgttggtgaaccccccaagcagcaatgatgcc
tgcctcagcattgtccacagcctcatgtgtcaccggcagggtggagagaatgagggcttt
gctaagcgtgccattgagagcctggtgaaaaaactgaaggagaagaaggatgagctggac
tcgctcatcactgccatcaccaccaatggcgttcatcccagcaagtgtgtcaccatccag
aggacgctggatggaaggctgcaggtggcagggaggaagggttttcctcatgtgatttat
gcacggctgtggcgctggcctgacctccacaagaatgaactcaagcatgccaagttctgc
cagtatgcctttgacctgaagtatgacaatgtgtgtgtcaacccctaccattatgagaga
gtggtgtctccaggcattgttggtctcagtcttcagaacacagcagcacctagcgggctc
atcaaagaggaatacattcatgactgtatacagatggacctcccacccggcatgcctctg
ttagatcaccaagcagccctgaagcttcctcctccagactgctatggccaaccccttcct
cgaccacagctgtcctcgaagccgcatggccccccacctgtaaccagatacactaacttg
cctgtctcacccaaagtgtctggctcaggctccatcctgccactgcagggcagtcacagt
gatggctgtctccaaagtacatccccacaggctcaagtcatgcccccagcacaacggtct
ccgagcccaagccaacccccacctcagcaacaggctgcccaacaactctcacagcccccc
cgcccacagcaaccctccctacctcctcctcactctcatgggcagaatggatacagcaac
aataaacactcccagagccaggcagccttccacatttggacaggcagcagcacagcctcc
tacactcctgtaggactccagtcgaacgggcgtagtcaccagcaaccttccctccatcat
ccaaaccaccactggtctccacatcattgtccaacctctttcccgccatcggtgtccaat
catccagagttttggtgctctatctcctactttgaaatggacgtccaggtgggtgagatg
ttcaaggtgccctccagctgccctgtagtgactgtggatggttatgttgacccgtcagga
ggcgatcgcttctgcctcggccagctgagtaacgtccaccgtacagatgccagtgaaaga
gccaggttgcacataggtaaaggtgtgcaactggagtgtcgtggtgagggcgatgtctgg
atgcgctgtatgagcgaccacgctgtgtttgtacaaagctactaccttgacagagaagca
ggccgagcaccaggtgatgctgtgcacaagatttaccctggagcctacatcaaggtgttt
gacctgcggcagtgccatagacagatgcagcagcaagcggcgacagctcaggctgccgct
ggcgcccaanggcctggtccgggtagtgttggaggtatcgcgcctgcagttagtctgtct
gcagcagctgggatcggtgtagacgacctaagacgactgtgcatcctgcggctcagcttc
gtgaagggctggggccctgactacccccggcagagcatcaaacacaccccttgctgggta
gaggtccatctacatcgagctctgcagcttctggatgaggtgttgcacaccatgccattg
gcagacccagggcctgctaactaa

DBGET integrated database retrieval system