KEGG   Monopterus albus (swamp eel): 109961724Help
Entry
109961724         CDS       T05607                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00590  Arachidonic acid metabolism
malb01100  Metabolic pathways
malb04370  VEGF signaling pathway
malb04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109961724 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109961724 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109961724 (ptgs2)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109961724 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109961724
NCBI-ProteinID: XP_020458446
LinkDB All DBs
Position
Unknown
AA seq 607 aa AA seqDB search
MNRLTFKVLLLALGFLVCEGGNPCCSEPCQNRGVCTALGADDYECDCTRTGYYGQNCTTP
EFLTWIKVTLKPSPNTVHYLLTHFKGFWNIINNISFLQDAIMRYVLTTRSHLIDSPPTYN
ADYGYKSWEAYSNLSYYTRTLPPVPQDCPTPMGVVGNKELPDVKVLAEKLLVRRQFIPDP
QRTSLMFAFFAQHFTHQFFKTDMKKGPAFTQSKGHGVDLSHIYGEDLEKQHKLRLFKDGK
LKYQILDGDMYPPTVQEVGVDMFYPPHVPDSHRFAVGHEAFGLVPGLMMYATIWLREHNR
VCDVLKEVHPDWDDERLFQTTRLIMIGETIKIVIEDYVQHLSGYHFKLKFDPQLLFKERF
QYQNRIASEFNTLYHWHPLMPDSFHIEEKEYNYKQFMFNMSVVTEHGINNLVDSFTKQIA
GRVAGGRNVPGAVLYVAIKSVEHSRKMRYQSLNAYRKRFSMMPYKSFEDMTGDKEMAAIL
KEMYGHVDAVELYPGLLVEKPRPNGIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFG
GSVGFDIVNTASLQKLVCNNVRGSCPVASFYVPDVKDTGSMINSSTSHSESSDINPTVIL
KERTTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacttacatttaaagttctcctgttggcactgggctttctggtctgcgaagga
ggtaacccgtgctgctcagagccatgccagaataggggcgtatgcacagcactgggagca
gatgattacgagtgtgattgcacacgtacaggatattatgggcaaaactgcacaacacct
gagtttctcacctggatcaaagtcaccctgaagccatcacccaacactgtccactacctt
ctcacccacttcaagggcttctggaacatcatcaacaacatctcatttctccaggatgcc
atcatgagatatgtgctgacaacccgatcacacttgattgacagtcccccaacttacaat
gcagattatggttacaaaagctgggaagcctattccaacctttcctactatacgcgtacc
ctcccacctgtgccgcaggattgcccaacccctatgggagtagtaggaaacaaggagctg
cctgatgttaaagttttggctgagaagcttctggtgaggagacagtttatcccagacccg
cagagaaccagcctgatgtttgcattttttgcacagcacttcactcaccagttcttcaaa
acggatatgaagaaaggacctgccttcacccagtctaaaggccatggggtggacctcagc
cacatttatggagaagacctggagaagcagcacaagctcagactcttcaaggatggaaag
ctcaaatatcagatcctggatggagatatgtaccccccaacagtacaggaagtgggggtt
gatatgttctacccccctcatgtccccgactctcaccgcttcgccgtgggccacgaggcg
ttcggcctggtccctggtctcatgatgtatgccaccatttggctgcgggaacacaaccgg
gtgtgtgacgtgttgaaggaggtgcaccctgactgggacgatgaaagactcttccagacc
acacggctcattatgattggtgagaccatcaagattgtgattgaagactatgtgcagcac
ctgagtggctatcacttcaaactcaagtttgatccccagctgctcttcaaggagcgtttc
cagtaccagaatcgcattgcatctgagttcaacaccctgtaccactggcacccgctgatg
cctgatagtttccacattgaggagaaagagtacaactacaaacagtttatgttcaacatg
tcggtagtgactgagcacggcatcaacaacctggtggattcgtttactaagcagattgca
ggacgggttgctggtggccgaaatgtcccaggagctgttttgtacgtggccattaagtcc
gtagagcacagcagaaaaatgcgttaccagtctctgaatgcctacaggaagcgattctcc
atgatgccctacaagtcttttgaagacatgacaggagataaagaaatggccgcaatactg
aaggagatgtacggacatgtcgatgctgtggagctctacccaggcttgctggtggagaaa
ccaaggcccaacggcatctttggggagaccatggtggagatgggggcacctttctccctc
aagggcttaatgggaaaccccatctgctccccagagtactggaagcccagcacctttgga
ggcagcgtgggctttgacatcgtcaacaccgcttccctgcaaaagctcgtctgcaataac
gtgcggggctcctgtcctgtggcgtccttttacgtgcctgacgtaaaagacacagggtcc
atgatcaactcaagcacatcccactcagaaagcagtgacatcaaccccactgtcatccta
aaagaacggactacagagctctaa

DBGET integrated database retrieval system