KEGG   Monopterus albus (swamp eel): 109961799
Entry
109961799         CDS       T05607                                 

Definition
(RefSeq) BH3-interacting domain death agonist-like
  KO
K04726  BH3 interacting domain death agonist
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109961799
   04217 Necroptosis
    109961799
   04115 p53 signaling pathway
    109961799
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109961799
SSDB
Motif
Pfam: BID UBZ_FAAP20 SmAKAP
Other DBs
NCBI-GeneID: 109961799
NCBI-ProteinID: XP_020458596
LinkDB
Position
Unknown
AA seq 197 aa
MEDLMNLPGGQNTALVILDFLQADCRNADYDKELHSLGRDLNITREVPCSDPRIQDVDDG
DLETDGHLPSCIAVSLDDIRPAVELLWPRNHEGAVIQQVAEELREIAAQLELSVVAQATQ
NLSRNITTTSLEQWKNHLTWEVQRVMRQGVGLAHLPQERVMVALTLTLVKGVCEHAPRLL
RNLFCVALHYICSLTLG
NT seq 594 nt   +upstreamnt  +downstreamnt
atggaagacctgatgaatctacccggtgggcaaaacaccgcactggtcattttggacttc
cttcaagcggactgtagaaacgcagattacgacaaggagcttcattccttgggccgtgac
ctaaatatcacccgggaagtgccgtgcagcgaccccagaatacaggatgtggacgacgga
gaccttgaaactgatggtcacctgcccagctgcattgcggtctctctagatgatattcgg
cctgcagttgagctgctgtggcctagaaaccatgaaggagcagtcattcagcaggttgca
gaagaactaagagaaattgcagcccagctcgaactcagtgttgtggcgcaggctacccag
aacctgtcaaggaacataacaaccacctccttggaacaatggaaaaaccacctcacctgg
gaggtgcagagggtgatgaggcagggtgtgggtctggcccatttaccccaggagcgagtc
atggtggcccttactctcactctggtgaagggagtgtgcgaacacgcaccacgactgctc
agaaacctcttctgcgtagcattgcattacatttgctctttaacacttgggtga

DBGET integrated database retrieval system