KEGG   Monopterus albus (swamp eel): 109961831
Entry
109961831         CDS       T05607                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04340  Hedgehog signaling pathway
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109961831 (ccnd2)
   04340 Hedgehog signaling pathway
    109961831 (ccnd2)
   04068 FoxO signaling pathway
    109961831 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109961831 (ccnd2)
   04115 p53 signaling pathway
    109961831 (ccnd2)
   04218 Cellular senescence
    109961831 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109961831 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C IFT81_CH K-cyclin_vir_C
Other DBs
NCBI-GeneID: 109961831
NCBI-ProteinID: XP_020458639
LinkDB
Position
Unknown
AA seq 297 aa
MELFCLEMDTNIRARPDPNLLCDDRVLQSLLTIEERFVPQYSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAMVPTKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLPEDKLALIRKH
VQTFIALCATDFSFAMYPPSMIATGSVGAAICGLQLDSADQSQWGDSLTDVLAKITNTEV
DVLKECQEQIERVLMSSLREGRQQQQQQQQTQRGPSDKGLDELDQSSTPTDVRDVNL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctgttctgcctcgaaatggacaccaacatacgagctcgtcccgatccgaaccta
ctgtgcgatgacagagtcctgcagagcttgttgaccatagaggagaggtttgtgccccaa
tattcctatttcaaatgcgtccagaaagatattcagccttttatgaggaggatggtcgct
acttggatgttggaggtttgtgaggagcagaagtgcgaggaagaggtttttcccttggcc
atgaactacttagacagatttttagccatggtacccaccaaaaagtgtaacctgcagctg
ctgggagcagtctgcatgtttcttgcatccaaattgaaagagactcgtccattaacagca
gagaagctttgcatctacacagataactccatcagacctcaagagctgctggaatgggaa
ctggtggtgttggggaagttgaagtggaacttggcagcagtgacaccaaacgacttcatc
gagcacattgtgaggaggctgccgctgcccgaggataagctggcactaatacgcaaacac
gtccagacgttcatcgccctctgtgccacagatttcagtttcgccatgtaccctccctcc
atgatcgccacaggaagcgtgggggcagcgatctgcggcctacagctggattcagctgac
cagtcacagtggggcgacagcctgacagatgtgctggctaaaatcacaaacacagaagtg
gacgttctcaaagagtgtcaggagcagattgagcgcgtgttgatgagcagtctgcgtgag
gggcggcagcaacagcagcagcagcagcagacacagagaggccccagtgataaaggtctg
gatgagctggatcaatcctccaccccgacagatgtccgtgatgtcaacttgtga

KEGG   Monopterus albus (swamp eel): 109963107
Entry
109963107         CDS       T05607                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04340  Hedgehog signaling pathway
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109963107
   04340 Hedgehog signaling pathway
    109963107
   04068 FoxO signaling pathway
    109963107
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109963107
   04115 p53 signaling pathway
    109963107
   04218 Cellular senescence
    109963107
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109963107
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 109963107
NCBI-ProteinID: XP_020461048
LinkDB
Position
Unknown
AA seq 286 aa
MGSSQVRAAWDPTVSGHRVIQRLLHVEERYMPSIFYITLIQRDPEQREELTKWALEVCCD
CGCDEAVFPLSVSLMDRFLSASLSLPASPYCLAAGCILIASKLTECDSVTADTLCAAAEY
SFQPSNLREMERVILATLRWDTAAVTPQDFLPHFLASVEQRGAGDTGESEGEWLSTLRRH
SDTLSTMCVCDSRFLGAPPSLVAAASLNCALRGLSNRGPSQLALMTEALAELCQTDLAVL
QCYSEMIEYALRQRLRSGHQQGPMEKDEEVENERPGTPTDMREIDF
NT seq 861 nt   +upstreamnt  +downstreamnt
atgggctcatctcaggtgcgagctgcatgggacccaaccgtgtcgggccatcgagtgatc
cagaggctgcttcacgtggaggagaggtacatgccctccatattctacatcaccctcatc
cagcgggatccagagcaaagggaggagctcaccaaatgggccctagaggtgtgctgtgat
tgtggctgtgatgaggcagtgtttcctctgtctgtctccctgatggacaggttcctgtct
gcctctttgtctctacctgcgtcaccgtactgcctggccgctggctgcatcctcatcgcc
tctaaactcacagagtgtgacagtgtcactgctgacactctctgtgctgcagccgagtac
agcttccagccctcaaacctgcgggaaatggagcgtgtcatcctcgctaccctccgatgg
gacacagcagcagtgactcctcaggacttcctcccacattttcttgcttctgtggagcag
agaggagccggagacaccggtgagtctgagggggagtggctctccaccctgcggcggcac
agcgacacactgtctaccatgtgtgtctgtgactcccgttttctgggagctccaccgtca
cttgttgctgcagcatcactgaactgtgccctgagaggtctcagcaacaggggcccctcc
cagctggctcttatgactgaagcactggcagagctgtgccagactgacctggcagtgctg
cagtgctatagcgagatgattgagtatgccctccgccagcggctgaggagtgggcatcag
cagggccccatggagaaagatgaagaggtggaaaacgaaagacctgggacaccaactgac
atgagagagattgacttctaa

KEGG   Monopterus albus (swamp eel): 109964433
Entry
109964433         CDS       T05607                                 

Gene name
ccnd3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109964433 (ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109964433 (ccnd3)
   04115 p53 signaling pathway
    109964433 (ccnd3)
   04218 Cellular senescence
    109964433 (ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109964433 (ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109964433
NCBI-ProteinID: XP_020463388
LinkDB
Position
Unknown
AA seq 318 aa
MDRSEDRQLNGSTDKNDEVGGVVVLRAGSDPTLTADLRVLHNLRALEKTCQVYPYFGTVQ
PDIQPYMRRLLTVWMFQVCEEQKCEEEVFPLAVQYLDCYLSRFTTEKSNLQLLGTVCMFL
ASKMRETVPLTASKLCIYTDNSVSVADILQWEMAVVSRLDWCLASVVPSDFLEPILHSLP
YVRPPHLHNMRRHVHSYIALAATDSRFSVFLPSTVACACVSAAMQKLKLLDAAVSSETVI
KFLTNLLAMDLSSVVLCSEQLGSVLELSLPSCFQGSVCRAHSSEVSYTPADIQDVVLTPV
TLAQEVKLKHSCQPPSYD
NT seq 957 nt   +upstreamnt  +downstreamnt
atggatcgttctgaagatagacaacttaatggatccacagataaaaatgatgaggtaggg
ggtgttgtggttctccgagccggcagtgaccccaccctgactgctgacctcagggtactg
cacaacctgagggctctggaaaagacttgtcaagtgtacccgtacttcgggacagtccag
ccagacatccagccatatatgaggagactactgacagtgtggatgtttcaggtgtgtgag
gagcagaaatgtgaggaggaggtgtttccactcgccgtgcaatacctggactgttacctg
agccggtttaccaccgagaagtctaatctgcagcttctagggacagtttgcatgttcctg
gcctccaaaatgagagagactgtccccctgactgccagcaagctttgtatctacacagac
aactcagtttcagtcgcagacattctgcagtgggagatggcagtggtgtccaggttagac
tggtgtctggcctctgtagtaccctctgacttcctggagccaattcttcattctctcccc
tatgttcgtccaccccaccttcacaacatgcgcaggcatgttcactcctacattgctctg
gcagccactgacagcaggttttcagtattcttgccctccactgttgcatgtgcctgtgtg
agcgctgccatgcagaaactaaagttactggatgctgctgtttcctctgagacagtgata
aagtttttgaccaaccttttggccatggatctgagctcagtcgtcctctgctctgagcag
ctggggagtgtgctggagctcagcctgccctcctgctttcagggtagtgtttgcagagcg
cacagctcagaggtcagctacacccctgctgacattcaggatgttgtactgacaccagtg
acactggctcaggaagttaagctgaaacactcctgccagcctcccagctatgattag

KEGG   Monopterus albus (swamp eel): 109967859
Entry
109967859         CDS       T05607                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04340  Hedgehog signaling pathway
malb04371  Apelin signaling pathway
malb04510  Focal adhesion
malb04530  Tight junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109967859 (ccnd1)
   04340 Hedgehog signaling pathway
    109967859 (ccnd1)
   04371 Apelin signaling pathway
    109967859 (ccnd1)
   04068 FoxO signaling pathway
    109967859 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109967859 (ccnd1)
   04115 p53 signaling pathway
    109967859 (ccnd1)
   04218 Cellular senescence
    109967859 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109967859 (ccnd1)
   04530 Tight junction
    109967859 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109967859
NCBI-ProteinID: XP_020469376
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDINLLNDRVLHTMLKAEESYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTSHDFIEHFLSKLKIYPTTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDTSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTESKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatccggagagcctaccaggacatc
aacctgctcaacgaccgagtcctgcacaccatgctgaaggcagaggaaagctacctaccg
tcaccaaactacttcaagtgtgttcagaaagaaattgtacctaaaatgaggaaaatagtt
gcgacctggatgttagaggtctgcgaggaacagaaatgtgaggaggaggtttttccgctg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaacacggctacag
ctgttgggagctacatgcatgtttctagcatccaagatgaaggagactgtccccttaacg
gcggagaaactttgtatctacacggacaactcggttcagcctggagaactgctgcaaatg
gaactgctggttctcaacaagttgaagtgggatctggcttcagtcacctctcatgacttc
attgagcatttcctctccaagctgaagatctacccaaccaccaagcagatcctcaggaaa
catgcccaaacctttgtggctctctgtgctacagatgttaacttcatcgccagtcctccg
tctatggtggcggcaggcagtgtggtggcagctgttcaaggtctctacctgaagagccaa
gatacctccttgtcctcccagaacctcaccaacttcctgtcacaggtcattcgcagtgac
ccggactgcttacggtcctgtcaggagcagatagagtctctgttggagtccagcctgcgg
caggctcagcagcacagcagcacaacagaatccaaacgtgtggacgaggacgtggacctg
tcctgcaccccgacagacgtcagagacatcaacatctga

KEGG   Monopterus albus (swamp eel): 109969706
Entry
109969706         CDS       T05607                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04340  Hedgehog signaling pathway
malb04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109969706
   04340 Hedgehog signaling pathway
    109969706
   04068 FoxO signaling pathway
    109969706
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109969706
   04115 p53 signaling pathway
    109969706
   04218 Cellular senescence
    109969706
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109969706
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109969706
NCBI-ProteinID: XP_020472441
LinkDB
Position
Unknown
AA seq 294 aa
MELYCLESDIPVKAQPDPNILYDDRVLQSLLTTEDRFLPQCSYFQRVQKDIHPYMRRMVA
GWMHEVCEEEKSNEDVFPLAINYLDRFLAVMPTKKSYLQLLGAVCMFLASKLKDCRPLSA
EKLCMYTDNSITPRELLDWELVVLGKLKWNMASVIPNDFIEHIIRRLPLPKDKLVMVRKH
TLTFIALCATDDRLAMNPPSMIATGSMGAAICGLQLDHTDQRLSRDNLTDLLAKITNTEM
DCLRACQEQIERVLATSLQQGQQYQKETRVRAGNKVREQQDQSSTPTDVRDVNL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagctttattgcctggagtcggacatacccgtgaaagctcaacctgacccaaacatc
ctctatgatgacagagtattgcaaagtttattaacaactgaggacaggttcttgcctcag
tgctcgtatttccagcgggtccaaaaggatattcacccttatatgagacgaatggttgca
ggctggatgcacgaggtgtgtgaagaggagaagagtaatgaagatgtcttccctttagcc
attaattatttagacagatttttagctgtcatgcccacaaaaaagagctatttgcagctt
ctgggagcagtgtgcatgtttctggcctccaagttaaaagattgcaggccactgtctgca
gaaaaactttgcatgtacacagacaactccatcacaccacgggaactgctggactgggaa
ctggtcgttctggggaaattgaagtggaacatggcctccgtcattccgaatgattttata
gagcacatcatacgtaggctccccctcccaaaagacaaactggtgatggtccgcaaacac
acactgacattcatcgccctctgtgccacagatgaccgtcttgccatgaaccctccttcc
atgatcgccactggcagcatgggagctgctatctgtggcctgcagctggaccacactgac
cagaggctgagtcgagacaacctgacagacctgctggccaagatcaccaacacagagatg
gactgtttgagggcatgtcaggagcaaatagagcgtgtgctggccactagcttgcagcag
ggtcagcagtaccagaaagagacccgggtcagagcgggaaacaaagtgagggagcagcaa
gaccagtccagcacccccacagatgtacgcgatgtcaacttatga

DBGET integrated database retrieval system