KEGG   Monopterus albus (swamp eel): 109962087
Entry
109962087         CDS       T05607                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04020  Calcium signaling pathway
malb04144  Endocytosis
malb04510  Focal adhesion
malb04540  Gap junction
malb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109962087 (pdgfra)
   04020 Calcium signaling pathway
    109962087 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109962087 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109962087 (pdgfra)
   04540 Gap junction
    109962087 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109962087 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109962087 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:malb04090]
    109962087 (pdgfra)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109962087 (pdgfra)
Protein kinases [BR:malb01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109962087 (pdgfra)
CD molecules [BR:malb04090]
 Proteins
  109962087 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 109962087
NCBI-ProteinID: XP_020459138
LinkDB
Position
Unknown
AA seq 1473 aa
MGGVKTYIVLGSMLAALLSVTSGLPPTIVPDKEALIVQPMSVFNISCTGKRNVIWAEPLQ
ENTYVYPGYYTATLFIYNATVENTGYYMCVYETQKDELQTDLEEENEAGIYVFVPDPQVP
FVPETPDNLVVQMDRNGVPISCRVSDPYFPVILRSVPSGEEMSAYYDSKMGFFGSLSPGQ
YQCETTVYGQTVTSAIYTVKTEGATVAPAEMEDFSVEVKASEETVRAGQPFTITCTTPTG
LGFQQQWLHPKKQAVDAVQLKETFPDRVIYTLSILEATSQDSGTYECSITHVITREVRVS
SVAVTVFEENSFVVLDYSGILATEFISLLEETEFTILIDAYPAPKVKWLKDGRALPGSYF
ILTKTSHLEGNRYQSILTFRQPLEKDNGNYTIIALSGSRTAQFSFTLKVKAPTAMMFPPS
SAPVLLPQLEEMVVPLHTPFTLTCHGEAQLAWEKPLDVSEQMQEDNSGLFISTITVEKAT
AMHTGYYICFYSRNATDEMEDSSIYIYVPDRDVPFVPSLVSFGNHILSDNEEMEIQCRVS
DPSANVTLVNVDTQLPVPSVYDSKRGALGIFTAGTYVCKALINGEEHYSEEYIVHGWTGA
AALHVELTAKQTALLVGDTITVTCLAQGSEILEDHWKYPGKLANRAIKAVHENKKDHEII
YTLTIPQASTKDSGIYSCSITDIITNESQTKQLAIRVFASEFMSIQPLFKEYEWAELDEV
REFRAEISSFPTAHVTWLKDGTPLSSVTEISTSLRQLNETSYMSVLTLIRAKEEDSGNYT
IRVENGNQSQDVSLMLEVRVPAVIVDLMDIHHGSAAGQSVLCIARGQPTPVVEWFICKNI
KHCANDSSSWGPLPANATEITVDSHIDKDNNLESQVMFGHLENTLAVRCLARNEMATVAR
EVKLVSSGPHPELSVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEY
IYVDPMQLPYDSRWEFPRDRLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPT
ARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCLYGDLVNYLHKNRDN
FLSLNPEKSKKDLDIFGINPADESSRSYVILSFESKGDYMDMKQADNTQYVPMLEMSNAS
KYSDIQRSNYDHPPSQKGSSEGEMDNLLSDDMNEGLTTTDLLSFTYQVAKGMEFLASKNC
VHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTT
LSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWN
SEPEKRPTFLGLSETVASLLPFSYKRHYERVNHEFLKSDHPAVTRVCMENDDAYIGITYK
NQGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSSS
STFAKREGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4422 nt   +upstreamnt  +downstreamnt
atgggaggggtcaagacgtatatcgtccttgggagtatgttggcagcgctactgtcagtt
acctctggactgccaccaaccattgtgcctgacaaagaagcattgatcgtgcagcctatg
tctgtgttcaacataagttgcaccggaaaaagaaatgtgatttgggccgagccgctgcag
gaaaacacctacgtttatccgggatactacacggcaacgctcttcatttataatgcaaca
gtagaaaacaccggctactacatgtgtgtatatgaaacccagaaggatgaactacagact
gacttggaagaagagaatgaggcgggaatatatgtctttgtgccagatccccaggtgcca
tttgttcctgagacccctgacaacttggttgtccagatggaccggaatggagtccccatc
tcctgtcgtgtgtcggacccctactttcctgtcatcctgaggagtgtccccagtggagag
gagatgtctgcctactatgacagcaagatgggcttctttgggagcctctctcctgggcag
taccagtgtgaaaccactgtgtatgggcagacagtcacaagtgcaatttacactgtgaaa
actgagggtgccactgtagcccctgcagagatggaggatttcagtgtggaagtaaaagct
agtgaggagacggtgagagcagggcagcctttcaccatcacctgcaccactcccacaggg
ctgggctttcagcagcagtggctccatcctaaaaaacaggctgtggatgcagttcaactg
aaagagacctttcctgaccgagtcatctacactctcagtatcctagaagccacctctcag
gatagtgggacctacgagtgctccatcacccacgtaatcaccagagaggtcagagtcagc
agcgtggctgttaccgtctttgaagaaaattcctttgtggtactggactacagtggaatt
ctagccactgagtttatcagccttttggaggagacagagtttactatcctgattgatgcc
tacccagcacccaaagtgaagtggctgaaagatggcagggctctaccagggagctacttc
atcctcaccaaaacgagccaccttgaaggcaaccggtatcagagcattctgacattccga
cagcctctggagaaagacaatgggaattataccattatagccctcagtggctctcggact
gctcaattctcttttactctcaaagtgaaagcccccactgcaatgatgttcccaccctcc
tctgcccctgtgctgctgccacagctagaggagatggtggtgcccctccacactcctttc
accttaacctgtcacggagaggcacaactagcctgggagaaaccactcgatgtgtctgag
caaatgcaggaggacaacagcggcctgttcatctccaccattactgtggaaaaagccact
gcaatgcacactggctactacatatgtttttacagcagaaatgccactgatgagatggag
gacagcagcatctacatctatgtgccagatcgagatgttccctttgtgccatcactggtg
agttttggtaaccacatcctgtcagacaatgaggagatggagatccagtgtcgagtatct
gatcccagtgctaacgtgaccctggttaacgttgacacccagctgcctgtgcctagtgtt
tatgacagcaagaggggtgctttggggatatttactgctggaacctacgtctgtaaggcc
ctaataaacggagaggaacattacagtgaggaatacatcgttcatggctggacaggtgct
gctgctctgcatgttgagctgacagccaagcagactgctctcctggtgggagacactatc
acagtcacctgtcttgctcagggatctgagattctggaagaccactggaaataccctgga
aaactggccaatcgtgcaatcaaagcagtgcatgagaataagaaggatcacgagatcatt
tacaccctgaccatcccacaagcctcaaccaaagacagcggcatctactcctgctccatc
actgatattattacaaatgagagccagacaaagcaactagctatcagagtgtttgcaagt
gagtttatgtccatccagccgctgttcaaagaatatgaatgggcagagttggatgaggtc
cgtgagttcagggccgaaatcagctccttccccactgctcatgtcacttggctcaaagat
ggcaccccactcagcagtgtgacagagatctccaccagtctccggcagctcaacgagacc
agctacatgagtgttctcaccttgatccgagccaaggaggaggacagcgggaactacacc
atacgagtggagaatggaaaccaaagtcaagatgtcagcttaatgctggaagtcagagtg
cctgcagtgattgttgacctaatggacatccaccatggctcagctgcaggccagtctgtg
ctgtgtattgctagagggcagcccacacctgtggtggagtggttcatttgcaaaaacatc
aaacattgtgccaatgactcatcctcctgggggcccctccctgccaatgccacagagatc
acagtggactcgcacatcgataaggacaataacctggagagccaggtcatgtttggccat
ctagagaacacattggctgtgcgctgcctggctaggaatgaaatggccactgtcgccagg
gaggtcaagctagtgtccagcggccctcatcctgagctgagtgtagctgctgctgtgctg
gtgctcctggtcattgtcatcatctcactcattgtcttggttgtaatctggaaacagaaa
ccacgatatgagatccgctggagggtcatagagtctgtgagcccagatggccatgaatac
atctatgtcgatcccatgcagcttccctatgactccagatgggagttcccccgtgacagg
cttgtgcttggtcgtgtcctgggctccggagcttttgggaaagtggtagaaggcaccgcc
tatggactcagtcgctcccaacccgtcatgaaggtggcagtaaagatgctgaaacccacg
gcacgatccagtgagaaacaggccctgatgtctgaactgaagatcatgactcatctggga
cctcatctcaacattgttaatctcctgggagcatgcactaagtcaggccctatctacatt
atcacagagtactgcctctacggagacctggtcaactacctgcacaaaaacagagacaac
ttcctcagtctgaacccagagaaaagtaaaaaagatctggacatctttggcatcaaccct
gcagatgagagcagccggagttatgtgatcctgtcctttgagagcaaaggagactacatg
gatatgaaacaagctgacaacactcagtatgtgcccatgctggagatgagcaatgcctcc
aagtactcggacatccaaaggtccaactacgatcacccaccctctcagaaaggctcgagt
gagggcgagatggacaacctgctatcagatgacatgaatgagggcctgaccaccaccgac
ctgctcagctttacctaccaagtggccaaaggcatggaattcctggcttccaaaaattgt
gtgcatcgggacctcgcagccaggaatgtccttctttctcagggcaaaatagtaaagatc
tgtgactttggactggccagagacatcatgcatgacaacaactatgtctccaaagggagt
acctttctcccagtgaagtggatggcacctgaaagtatttttgacaatttgtacaccact
ctcagtgatgtttggtcctacggcatcctcctctgggagatattctccttaggtggcacc
ccatacccagggatggttgtggactcgagcttctacaacaagattaagagtggatacagg
atgtccaaaccagagcatgcacctcatgatgtgtatgagatgatgatgaagtgctggaac
agtgagccagagaagaggcccacttttctgggtctgagtgaaactgtagcttctttgctg
cccttcagctacaagagacattatgagagggtgaaccacgagttcctaaaaagcgaccat
cctgctgtgactcgggtgtgcatggaaaatgatgacgcctacatcggcatcacctacaag
aaccagggcaagctgaaggacagggaaagcggctttgatgaacagcggctgagctctgac
agtggctacatcattcccttgcctgacctggatcctatatctgatgatgaatatggaaag
aggaacagacacagctcacagacgtctgaggagagtgccatcgaaacgggctccagcagc
tccacctttgctaagcgcgagggtgagactctggaggatatcacgctgctggacgagatg
tgtctggactgtagtgacctggtggaggacagttttctgtga

DBGET integrated database retrieval system