KEGG   Monopterus albus (swamp eel): 109962203Help
Entry
109962203         CDS       T05607                                 

Gene name
plcb1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
malb04020  Calcium signaling pathway
malb04070  Phosphatidylinositol signaling system
malb04261  Adrenergic signaling in cardiomyocytes
malb04270  Vascular smooth muscle contraction
malb04310  Wnt signaling pathway
malb04371  Apelin signaling pathway
malb04540  Gap junction
malb04621  NOD-like receptor signaling pathway
malb04912  GnRH signaling pathway
malb04916  Melanogenesis
malb04933  AGE-RAGE signaling pathway in diabetic complications
Module
malb_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109962203 (plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109962203 (plcb1)
   04371 Apelin signaling pathway
    109962203 (plcb1)
   04020 Calcium signaling pathway
    109962203 (plcb1)
   04070 Phosphatidylinositol signaling system
    109962203 (plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109962203 (plcb1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109962203 (plcb1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109962203 (plcb1)
   04916 Melanogenesis
    109962203 (plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109962203 (plcb1)
   04270 Vascular smooth muscle contraction
    109962203 (plcb1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109962203 (plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109962203 (plcb1)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     109962203 (plcb1)
Membrane trafficking [BR:malb04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    109962203 (plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    109962203 (plcb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y C2 EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 109962203
NCBI-ProteinID: XP_020459353
LinkDB All DBs
Position
Unknown
AA seq 1244 aa AA seqDB search
MAGAQPGVHALQLKPVSVPESLRKGNKFMKWDDDSTTVTPVTLTVDPKGYFLYWTDQNKD
TDLLDIAYIKDARNGKCTKMPKEAKLRELLDVSSLAGKMENRMLTVVSGPDMVNITYLNF
MAFQEETAKEWAEELFKLASNLMVQNMSREACLEKAYTRLKLQLNPEGRIPVKNIFRVFS
ADRKRVETALENCNLPSGRNDSIPQEDFTPEVYNMFLSNICPRPELDHIFSDVGAKSRPY
LTVEQMTEFINSKQRDPRLNEILYPPLKPEQVQVLVDKYEPNVLLAQKGHISVEGFAKYL
TGEENSIIPPEKLDQSEDMTLPLSHYFINSSHNTYLTAGQLAGNSSVEMYKQVLLIGCRC
IELDCWKGRTTEEEPVITHGFTMTTEISFKEVIEAISECAFKTSPFPIILSFENHVDSPK
QQAKMAEYCRSIFGDALLTEPLEKYPLESGVPLPSPMELMGKILVKNKKKYHKTDGSTKK
KLSEQVSNTYSDSSSVCEPSSPSAGSTKEEMADSSQPTEGAELSLRPHGRKSIGEVEAES
EDEDDDDDDCKKGSMDEGTAGSEAFATEEMSNLVIYIQPVKFNSFEASKKINRSYQMSSF
VETKALEQLTKSPVEFVEYNKLQLSRIYPKGTRVDSSNYNPQLFWNAGCQLVALNFQTID
LSMQLNLGMYEYNGKCGYRLKPEFMRRPDKHFDPFTESTVDGIVANTLSVKIISGQFLSD
KKVGTYVEIDMFGLPVDTKRKAFKTKTSQGNAINPVWEEEAIVFKKVVLPTLASLRIAVF
EEGGKFIGHRIIPVSAIRPGYHYITLRNEKNQSLTLPALFVYVEVKDYVPDTFADVIEAL
SNPIRYVNLMEQRANQLAALTLEEGGEEEGDKEVEAGSDAPSESKVDQRVTLPAENGVSH
TPILAQKPPSLVGQNQSAGSLKPSMKTEDIIHSVLTELEAQTVEELKQQKGFVREQRKQY
KEMKELVRKHHRKTSELIKEHTARMSELQSQHQRRRSTLQKSHKRDGKKSRSEQSLSTLD
QELCELDQESSQRLTELKEQQQQQLLKLRQEQYYSEKYQKREHIKQLVEKLTTIAEECQS
VQLKKLRDICEKEKKDIKKKMDKKRQEKISEVKSKDKNVTEEEKLEINRSFVNEVVQYIK
RLEDAQSKRQERLLEKHKDIRQQILDERPKLQSDLDQEYQDKFRRLPVEIQEFVQDSSKA
KLSDDSVHGNLIASPTTEKLNYKASQSEDDIEEGSSEQVYDTPL
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcacagcctggagttcatgcgctgcagctcaagccagtgtccgtgcccgag
agcctaagaaagggcaacaaatttatgaaatgggatgatgattccaccaccgtgacccct
gtgactttaacagttgaccctaaaggttacttcctgtattggactgaccagaacaaggat
acagacctactggatatagcatacataaaagatgccaggaatggaaagtgtaccaaaatg
ccaaaggaagctaaactgcgtgagctgctggacgtcagctccctggcgggtaagatggag
aacaggatgctgacagtggtgagtggtcctgacatggtcaacatcacctacctgaacttc
atggctttccaggaggagacagctaaggaatgggcagaagaactgttcaagctggcatct
aacctcatggtacagaacatgtccagggaggcctgccttgagaaagcatacactcggctg
aagctacagctcaaccctgaggggcgaatccctgtcaagaacatcttcagggtgttctca
gcagataggaagcgagtggagacagccctggaaaactgcaacctaccttctggcaggaat
gactccatcccacaggaggacttcactccagaggtgtataacatgtttctgagcaacatc
tgcccccggcccgagctggaccacatcttctctgatgttggtgctaagagtcgcccatac
ctcacggtggaacagatgacagagttcattaacagtaaacagcgagaccctcgtctcaac
gagattctctaccctcctctcaaaccagaacaagtccaggtgctggtggacaaatatgaa
cccaatgttttgctggcacagaaaggtcatatctcggtggaaggctttgctaaatatctg
actggtgaggagaacagcatcatcccccctgagaagctggaccagagtgaagacatgacc
ttacccctctcccactatttcatcaactcctcacacaacacatacctcacagccggccag
ctcgcagggaactcctcagtggagatgtacaagcaggtgctcctgatagggtgccgctgc
atagaactggactgctggaagggtcgcaccactgaagaagagcccgtcatcactcatggc
ttcaccatgacaactgaaatctccttcaaggaggtgattgaggctatctcagagtgtgcc
ttcaagacttcacccttccccatcatcctgtcttttgagaaccacgtagactcaccaaag
cagcaggctaaaatggcagagtactgtcgctcaatatttggagatgcattactgacagaa
cctctggagaaatatcctctggagtctggtgtgccactacccagcccgatggagctgatg
ggaaaaatcttggtgaagaacaagaagaaataccacaagacagatggaagcaccaagaag
aaactgtcagagcaggtttccaacacctacagcgattcttccagcgtgtgtgagccctcc
tccccgagcgcaggttcaaccaaagaggagatggcagattcctcgcagcccactgagggt
gctgagctcagcctgaggccacatggcagaaagtctatcggtgaggtagaggcagaaagc
gaagatgaagatgatgatgatgatgactgtaaaaagggctcaatggatgagggtacagca
ggcagtgaggcatttgccactgaagaaatgtccaacctggtcatctacatccagccagtc
aaatttaacagcttcgaggcttccaaaaagatcaatcgcagctaccagatgtcatccttt
gtagagaccaaagctttggagcagctgaccaaatctcctgtagagtttgtggaatacaac
aagctgcagctgagcaggatctaccctaaaggaacccgagtggattcatccaactacaac
cctcagctcttctggaacgccggctgtcagcttgtggcgctcaacttccaaaccattgat
ctgtccatgcagctgaacctgggcatgtatgagtacaatgggaaatgtggctacagactc
aaaccagagtttatgagacggccagacaagcactttgacccttttactgagagcacagtg
gatgggatagtagccaacacactctctgtgaagatcatctcaggccagttcctgtctgat
aagaaggtaggcacgtatgtggagattgacatgttcggcttaccggtggacaccaagaga
aaagcgttcaagaccaagacatctcagggcaatgccatcaaccctgtctgggaagaagag
gccattgtcttcaagaaggttgttctacccacacttgcttcattacggatagctgtgttt
gaagaaggagggaagttcattggtcatcgtattattcctgtgtcagccatccgtccaggc
tatcattacatcacactaaggaatgagaagaaccagtccctcacattgcctgctctgttt
gtgtatgtagaagtaaaggactatgtccccgacacatttgcagatgtcattgaagccttg
tccaatcccatccgctatgtcaacctgatggagcagagagccaatcagctggctgctctc
actctggaggagggaggagaggaggagggtgacaaagaggtagaggcaggaagtgatgcc
ccctcagaatctaaggtggaccagagggtaacgttgcctgcagagaatggagtgagccac
acacccatcctcgcccagaaacccccctcgctggttggccagaaccagtctgcaggctca
ctgaaaccctcaatgaagactgaagacatcattcacagtgttcttactgaactggaggct
caaactgtggaggaactgaagcaacagaagggctttgttcgggagcagaggaagcagtac
aaggaaatgaaggaactggttcggaaacaccaccgcaagaccagcgagctgatcaaggaa
cacacagctcgtatgtcggagctccagagccagcatcagcgtcggcgctccaccctgcag
aagagccacaaacgagacggtaagaaaagccgatccgagcaatctctgtcgaccctggac
caggagctgtgtgagctggatcaggagagcagccagaggctcacagaactgaaggaacag
cagcagcaacagctcctcaaacttcgccaggaacaatactacagtgaaaagtaccaaaaa
cgagaacacatcaaacagctggttgagaagctgaccactatagcagaggaatgccagagt
gttcagcttaagaagctcagagacatctgtgagaaagaaaagaaggatattaagaagaaa
atggacaagaaaaggcaagagaaaatcagtgaagtcaaatctaaagacaagaatgtaaca
gaggaagagaagctagagatcaacagatcatttgtcaatgaggtggtgcagtacatcaaa
cggctggaagatgcgcagagtaaaagacaggagagactcctggagaagcacaaggacatc
cgccagcaaatcttggatgaaaggccaaagctacagagcgacctggaccaggaataccaa
gacaaatttcgccggctgcccgtagagatccaagagtttgttcaagacagcagcaaggcc
aagcttagcgatgacagcgtccacggaaacctcatcgcctccccgacaacagagaagcta
aactacaaggcgtcacagtcggaggatgacatagaggagggctcatcggagcaagtctac
gacactcccctttag

DBGET integrated database retrieval system