KEGG   Monopterus albus (swamp eel): 109962404
Entry
109962404         CDS       T05607                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04145  Phagosome
malb04350  TGF-beta signaling pathway
malb04510  Focal adhesion
malb04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109962404
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109962404
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109962404
  09143 Cell growth and death
   04115 p53 signaling pathway
    109962404
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109962404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109962404
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109962404
   04990 Domain-containing proteins not elsewhere classified [BR:malb04990]
    109962404
Membrane trafficking [BR:malb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109962404
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109962404
Domain-containing proteins not elsewhere classified [BR:malb04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109962404
SSDB
Motif
Pfam: TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS EGF cEGF Laminin_G_3 TSP1_CCN Laminin_G_2
Other DBs
NCBI-GeneID: 109962404
NCBI-ProteinID: XP_020459750
LinkDB
Position
Unknown
AA seq 1017 aa
MKLTGIFLLLMLWTCESARVAESREDNSVFDLFELVRVPKKNHGVTLVKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSIHAERGFLLLLNFKQFKRTRGSLLTVEKLDGSGPVLEIVS
NGKANTLDIVFSTENKQQVVSIEEAYLATGHWKNITLFVQEDRAQLYAGCEEVNAAELDA
PIQSILTQETPTSAQLRIGKGAVKDRFMGVLQNVRFVFGTTLDAILRNKGCQSSMTTETM
ILENLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLVSMFKELRGLGVVVKELSNELRQLTD
ENKPINIHSGVCLHNGIVYKNKDEWTVDDCTECTCQNSATVCRKISCPLIPCANATVPDG
ECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGTQQRGRSCDRINNNCEGTSVQARDCYL
QECDKRFKQDGNWSHWSPWSSCSVTCGSGVITRIRLCNSPTPQFGGKDCKGEGRQTETCL
KSPCPINGNWGPWSPWDTCTLTCGGGVQTRKRLCNDPTPKYGGKECVGDAKDTQMCNKQT
CPIDGCISNPCFAGAKCTSFPDGSWKCGKCPTGYTGNGIKCKDIDECKEVPDACFEFNGV
HRCENTDPGYNCLPCPPRFSGPQPFGRGVEQAVANKQICTPRNPCIDGSHDCNKNARCIY
LGHFVDPMYRCECKPGYAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCPNLPNSG
QEDYDKDDTGDACDNDDDNDGITDDRDNCPFIYNPRQYDYDHDDVGDRCDNCPYNSNPDQ
TDTDNNGEGDACAVDIDGDGIMNENDNCPYVYNVNQKDTDLDGVGDMCDNCPLEHNPDQV
DSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGRGDACDYDDDNDGSWT
LMVMAVEMLAKMTLTKTTCLTSMMCALKTSILVRQTSGSSRWFLWTPKAPPRLILTGLSD
IRAKSWFRLSTATLALLLGTTSSMQWTSVGLSSSTQIGMMIMLALCLATSPAPGSML
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgaagttgactgggatatttttgctattgatgctgtggacctgcgagagcgccagagtt
gcagagagccgagaagacaatagcgtgtttgacttgtttgagctcgtcagagtccccaag
aagaaccacggggtcaccctggtcaaaggagatgacccgtacagccccgcatacaagatc
ctcaatccagacctcatcccgccggttccagagagcgcttttagggacctgatcgattcc
atccatgccgagaggggattcctcctgctgctcaacttcaagcagttcaaacggacccgg
ggaagcctcttgaccgtggagaaactggacggctctggacccgtgttagagatagtctcc
aacggcaaggcgaacaccctggacatagttttctccaccgagaacaagcagcaggtggtt
tccatcgaagaagcctatctggctacgggccactggaagaatatcacgttgttcgtgcag
gaggatcgggcgcagctgtacgcgggatgcgaggaggtgaacgcagctgagttggatgcg
cctatccagagcatcctgacgcaggagaccccaaccagcgcgcagctcaggattggcaag
ggagccgtgaaggacaggttcatgggggtcctacagaacgtgcggtttgtgtttggaaca
acactggatgccatcctccgcaacaaaggatgtcaaagttccatgaccactgaaaccatg
atcctggagaacctcaatggctcctcggccatcagaacagagtacactggacataagact
aaagacctgcagatggtctgtggattctcctgtgaggacctggtcagcatgtttaaggag
ctgagaggccttggtgttgtggtgaaggagctgtccaatgaactccgccagctaacagat
gagaacaagcctattaacattcacagtggcgtctgcctccacaatggcatcgtttacaag
aacaaagatgagtggacggtcgatgactgcactgagtgcacgtgtcagaactctgctact
gtgtgccggaagatctcctgtcccctgatcccctgtgctaatgccactgttcctgatgga
gagtgctgcccacgctgtggaacaccgagcgactatgcagaggacggctggtcgccatgg
tctgaatggacccattgttctgtgtcatgtgggcggggcacccagcagcgcgggcgctct
tgcgaccgtatcaataacaactgcgagggtacctctgtgcaagcccgtgactgctacctc
caggagtgtgacaagcgcttcaagcaggatggcaactggagccattggtcaccctggtct
tcctgctcagtcacctgtggttccggtgtcatcactcgtatccgcctctgtaactctccc
accccccagttcggaggcaaggactgcaagggagagggccgtcaaactgagacatgtcta
aagtctccatgccccatcaatggcaactggggaccctggtcaccatgggatacatgtact
ctcacctgtggaggtggtgtccagactcgtaaacgcctgtgcaatgaccccacaccaaaa
tacggtggtaaagagtgtgttggagatgccaaagacactcagatgtgcaacaagcaaacc
tgccccatcgacgggtgcatatctaacccctgttttgctggagccaagtgcaccagtttc
cctgatggttcctggaagtgtggaaagtgcccgacaggctacacgggcaacggtatcaag
tgtaaagatattgatgagtgcaaagaagtcccagatgcttgctttgagtttaatggtgtg
caccgctgtgaaaatacagatcctggctacaactgtctgccctgccctcctcgcttctca
ggaccccagccatttggcagaggtgtggagcaggctgttgcaaataaacagatatgtaca
ccccgcaatccctgcattgatggaagccacgactgcaacaaaaatgcccgctgcatctac
ctcggacactttgtcgatcccatgtatcgctgtgagtgcaagcccggttatgctggcaat
ggtcatatctgtggagaggacacagatctggatggatggcccaatgctgacttggtgtgt
gtggagaatgcaacctaccactgcaaaaaggacaactgccccaacctccccaattctggt
caggaagattatgataaagacgacactggagatgcttgtgacaatgatgatgacaacgat
ggcattactgatgacagagacaactgtccattcatctacaacccaagacagtatgactat
gaccatgatgatgttggtgaccgctgtgacaactgcccctacaacagtaaccctgaccag
acggacacagacaacaatggagagggagatgcctgtgctgtggacatcgacggagatggc
ataatgaatgagaatgacaactgtccctatgtgtacaacgtcaaccagaaagacacagac
ctggacggggtgggagacatgtgcgataactgccccctggaacataatcctgatcaggtt
gattcagatgatgaccgtgtgggagacaagtgtgatagtaaccaagatattgatgaggat
ggacaccagaacaacctggacaactgcccatacattcccaacgccaaccaggctgaccat
gacaaggacggcagaggagacgcgtgtgactatgatgacgataatgacggtagctggact
ctgatggtgatggccgtggagatgcttgcaaagatgactttgaccaagacaacgtgcctg
acatctatgatgtgtgccctgaaaacttcgatattagtgagacagacttccggaagttcc
agatggttcctttggaccccaaaggcacctcccagattgatcctaactgggttgtccgac
atcagggcaaagagctggttcagactgtcaactgcgaccctggcattgctgttgggtacc
acgagttcaatgcagtggacttcagtgggactttcttcatcaacacagatagggatgatg
attatgctggctttgtgtttggctaccagtccagctccaggttctatgttgtga

KEGG   Monopterus albus (swamp eel): 109967980
Entry
109967980         CDS       T05607                                 

Gene name
thbs1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04145  Phagosome
malb04350  TGF-beta signaling pathway
malb04510  Focal adhesion
malb04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109967980 (thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109967980 (thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109967980 (thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    109967980 (thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109967980 (thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109967980 (thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109967980 (thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:malb04990]
    109967980 (thbs1)
Membrane trafficking [BR:malb04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109967980 (thbs1)
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   109967980 (thbs1)
Domain-containing proteins not elsewhere classified [BR:malb04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   109967980 (thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 TSP1_ADAMTS EGF_CA cEGF Laminin_G_3 EGF TSP1_CCN Laminin_G_2
Other DBs
NCBI-GeneID: 109967980
NCBI-ProteinID: XP_020469590
LinkDB
Position
Unknown
AA seq 1170 aa
MMLCGIFLLLMVWNCKGTRLAESRDDDSVYDLFDLARVNKRHHGVSLVKGDDPYSPAYKI
LNADLIPPVPDSSFRDLLDSIQAERGFLLLINMKQFKKTRGSLLTIEKNDGSGSLFEITS
NGKANTLDVVYSTMNQQQVVSIEETDLATGHWKNITLFVQDDWVQLYVGCEEINVSEMDV
PIHRVLSQEVADIARLRIGKGAVKDKFMGVLQNVRFVFGTTLQTLLRNKGCQSGAALTDV
MTVDNPVNGSSPAIRTDYTGHKAKDLQSVCGFSCDDIASMFQELKGLGVVVKQLSNELRK
VSVDSQLLINQMNIHSGVCIHNGIVHKDKDEWTVDGCTECTCQNSATMCRKISCPLIPCA
NATVPDGECCPRCGTPSAYAEDGWSPWSEWTHCSVTCGRGIQQRGRSCDRINSNCEGTSV
QTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGTDCQGEG
RQTKICHQLPCPIDGGWGPWSPWNTCTVTCAGGIQNRKRLCSDPVPKYGGKDCVGDATMS
QVCNKQDCPIDGCLSNPCFPGTRCTSFPDGSFKCGKCPLGYTGNGITCKDIDECKEVPDA
CHTHNGVHRCENTEPGYNCLQCPARFSGPQPFGRGVEQATAKKQVCKPRNPCQDGSHDCH
KNANCIYLGVFSESMFRCQCKPGYAGDGRICGEDTDLDGWPNTDLLCIVNATYHCKKDNC
PRLPNSGQEDHDKDGLGDECDNDDDNDGIPDDRDNCPREYNPAQYDADRDDVGDSCDNCV
FEANTDQTDTDNNGEGDACAVDIDGDGILNENDNCPYVYNVDQRDTDRDGVGDHCDNCPL
EHNPDQIDSDSDLVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGXXXXXXX
XXXXXXXXXXXXXSNPDQLDSDGDGRGDACKDDFDQDNVLDIYDVCPENFAISETDFRRF
QMVPLDPKGTSQFDPNWVVRHQGKELVQTVNCDPGIAVGYDEFSAVDFSGTFFINTDRDD
DYAGFVFGYQSSSRFYTVMWKQITQTYWSNTPTRAQGYAGLSIKVVNSTTGPGEHLRNAL
WHTGDTPGQVRTLWHDPKNIGWKDFTAYRWHLTHRPKTGLIRVVMYEGKRIMADSGNIYD
KTYAGGRLGLYVFSQEMVYFSDLKYECRDT
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgatgctgtgcggcatctttttgctgttgatggtctggaattgtaaaggcacgaggctg
gcagagagtcgagatgatgacagtgtgtatgacttatttgatctggcccgagtgaacaag
agacatcacggagtgagtttggtcaaaggcgacgatccctacagccctgcatacaaaatc
ctgaatgcagacctgatcccccccgtccccgacagctccttcagggacctcctcgactcc
atccaggctgagaggggcttcctcctcctgatcaacatgaagcaattcaagaaaaccaga
ggcagccttttaactatcgagaagaatgacggatctggatccttgttcgagatcacttcc
aatggcaaggcgaacactctggatgttgtgtactccaccatgaaccagcagcaggtcgtg
tccatcgaggagacggatctggccactggacactggaagaacatcacactgtttgttcag
gatgactgggtgcagctttatgtcggctgtgaggagatcaatgtttcggagatggacgtg
cccattcatagagtgctgtcccaggaggtggcagacattgccaggctcaggattggaaag
ggagctgtgaaggacaaattcatgggcgtgcttcagaatgtgcgctttgtctttgggacc
actctgcagactctactgagaaataaaggatgccaaagtggagctgccttaactgatgtc
atgacagtggacaacccagtcaatggctccagccctgccattaggactgattacaccggc
cacaaagccaaagatctgcagtctgtctgtggcttctcctgtgacgacatcgccagcatg
tttcaggagctcaagggactcggtgtagttgttaaacagctgtcaaatgagctccgcaaa
gtgtctgtggacagccaactgctgataaatcaaatgaacatccacagcggagtttgcatc
cacaacggcatcgtgcacaaagacaaggatgaatggactgtggatggctgcaccgaatgc
acctgccagaactcagctactatgtgtcgcaaaatctcctgccctctgatcccatgtgct
aacgccacagtgcctgacggagagtgctgccctcgctgtggaacaccaagtgcctatgca
gaggatggttggtccccctggtctgaatggacccattgttcagtcacttgtggtcgtgga
atccaacagcgtggacgctcctgtgaccgcatcaacagcaactgtgagggcacctctgtg
cagacccgtgactgttatccccaggaatgcgacaaacgcttcaaacaggatggtggttgg
agccactggtctccctggtcttcgtgctctgtgacctgtggtgagggggtcatcacccga
atccgcctctgcaactcccccacaccccagatgggtggcacagactgtcagggagaagga
cgtcaaaccaaaatttgccaccagttgccttgtcctatcgatggaggttggggaccttgg
tcaccttggaacacctgcactgttacctgtgctggaggaatccagaaccgcaaacgtctc
tgctctgaccctgtgcccaaatatggaggaaaggattgtgttggtgatgccaccatgtct
caagtgtgcaacaaacaggattgccctattgatggttgtctctccaatccatgcttccct
ggcactaggtgtaccagcttccctgatggctccttcaagtgtggcaagtgtccacttggc
tacactgggaatggtatcacctgcaaggacattgatgagtgcaaagaggtccctgatgct
tgccacactcataacggagtccatcgctgtgagaacactgagcctggttacaactgcctg
caatgccctgcacgtttttccgggccccagccctttggaagaggagtggaacaggcaact
gctaagaaacaggtttgcaagccccgtaacccttgccaggacggcagccatgactgccat
aaaaatgcaaactgcatctacttgggtgtcttctccgagtccatgttccgctgtcagtgc
aagccagggtatgccggagatggccgtatttgtggagaggacactgacctggacggatgg
cccaacactgacctgctctgcattgtgaatgcgacctaccactgcaagaaggataactgc
cccaggcttcccaactctggccaggaagatcatgacaaagatggcctgggtgatgaatgt
gacaatgatgatgacaatgatgggatcccagatgacagggacaactgccccagagagtat
aatcctgcccagtatgatgcagacagggatgatgtaggcgacagctgtgacaactgtgtg
tttgaggctaacactgaccaaacagacactgacaacaatggagagggtgatgcctgtgct
gttgacattgatggtgatggcattttgaacgaaaacgacaattgtccatatgtttacaat
gtggaccagagagataccgacagggacggagtgggagaccactgcgataactgccctctg
gagcacaacccagatcagattgactctgactcagatctcgtaggagacaagtgcgacaac
aaccaggacattgacgaggatggtcaccagaacaacttggacaactgcccctacatcccc
aatgccaaccaagcagaccatgacaaagatggcaagggtnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnctcaaaccctgatcagttggac
tctgatggtgatggccgtggtgatgcgtgcaaagacgattttgaccaagacaatgtgctt
gacatctatgacgtgtgcccagagaattttgccattagcgaaacagacttccgcagattc
cagatggttcctctggaccccaagggcacctcccagtttgatcccaactgggtggttcgg
catcagggcaaggagctggtgcagactgtcaattgtgatcctgggattgctgtcggttat
gatgagttcagtgctgtggacttcagtggaacattcttcatcaacacagacagagatgat
gactatgctgggtttgtgtttggctatcagtccagctcacgcttttacacagtgatgtgg
aaacagatcacacagacctactggtcgaacacaccaacaagagctcaaggctacgctggc
ctgtcaataaaagtggtcaactccaccactgggcctggtgagcatttgaggaacgccttg
tggcatactggagataccccaggacaggtccgcacactgtggcatgacccaaaaaacatt
ggctggaaggatttcactgcctacaggtggcatctgacccacagacccaagactggactt
attagagttgtaatgtatgaaggcaaaagaatcatggctgattctggaaacatctatgac
aagacatatgccggtgggcgactaggcttgtatgtgttctctcaagagatggtgtacttc
tcagacctcaaatatgaatgcagagatacataa

DBGET integrated database retrieval system