KEGG   Monopterus albus (swamp eel): 109962566
Entry
109962566         CDS       T05607                                 

Gene name
siah1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04120  Ubiquitin mediated proteolysis
malb04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109962566 (siah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109962566 (siah1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109962566 (siah1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:malb04121]
    109962566 (siah1)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109962566 (siah1)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    109962566 (siah1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 109962566
NCBI-ProteinID: XP_020460058
LinkDB
Position
Unknown
AA seq 286 aa
MDEEMSRQTATALPTGTSKCPPAQRVPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQ
SGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKTE
HEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAV
DWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTW
EATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 861 nt   +upstreamnt  +downstreamnt
atggacgaagaaatgagtcgccagactgccaccgcgctgcccacaggaacctccaagtgc
ccccctgcccagcgcgtgcccaccctgtcaggcaccaccgcctccaacagtgacctggcc
agcctgtttgagtgtcctgtttgctttgactatgtcctaccccccatcctgcagtgccag
tccggacacttggtatgctccaactgccggcccaagctcacctgctgccccacctgccga
ggacctctgggctctatcaggaacctggccatggagaaggtggctaactctgtcctcttc
ccctgcaagtatgcctcatcaggctgcgaagtcaccctgcctcacactgacaagacggag
cacgaagagctgtgcgagtttcggccgtactcctgcccctgccctggcgcctcctgcaag
tggcagggttccctggatgctgtcatgcctcacctgatgcaccagcacaagtccatcacc
acactgcagggcgaggacattgtattcttggccacagacatcaacctgccaggcgcagtc
gactgggtgatgatgcagtcctgctttggcttccacttcatgttggtgctggagaagcag
gaaaagtacgacggccaccagcagttcttcgccatcgtgcagcttatcgggactcgcaag
caggctgagaactttgcctaccggctggagctcaatgggcaccggcgccgcctaacctgg
gaggccacaccgcgctccatccatgagggcattgccacggccatcatgaacagcgactgc
ctggtgtttgacacatccattgcacagctgtttgctgagaacggcaacctaggcatcaac
gtcaccatctccatgtgctaa

DBGET integrated database retrieval system