KEGG   Monopterus albus (swamp eel): 109962631Help
Entry
109962631         CDS       T05607                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109962631
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109962631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 109962631
NCBI-ProteinID: XP_020460177
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MPGERLTVRGTSDVGRFPGSAPPIRVELTIQKEEEKKQEEGGCLGWFRKMCPCCCKRQNS
TSYDITDKVEFIKSPEPELIKPKPENGEAKEMEEMRLSLCSVDLLSSKTGRNRLEHHTDL
YHGDDLIIRRGQTFQIELELNRPFCADTDKLLLDLKTGSLPMVSKGTHVIIPVVDHLEDE
RWEAKIVEQNGNKIKLSVNSPASAVIGLYGLSVTISSLKDGPANTHNSNKNIIMLFNPWC
EEDTVFLDEQDERKEYVLNDIGRIYYGTENQIGARTWNFGQFHEGILDACLFVLEKSDMP
PSGRRDPVNVVRVISAMINAQDDFGVLVGNWSGNYSDGVSPAAWSSSVEILRKYHSTNGT
PVSYGQCWVFSAVTTTVLRCLGIPTRSVTNFQSAHDTDTSLTTDVYLDENMEPIDYLNSD
SVWNFHVWNDCWMARLDLPPGHGGWQAIDSTPQETSQGTFRCGPASVNAIRSGHVYLKHD
TPFIFAEVNSDKIYWQRNLDGTFSQIYAEKKAVGHYISTKAVGSDERADITHLYKHEEGS
EEERIAVETASRYGSKPNIYSTPMAEDVNVEVRMAGEGPRMGGDAKLSILVKNLSSQPRR
TTLHSQVAVMYYTGVLKGTIKKEELPVELMPNEEKSIEWVLPYQQYQNQLVDQAALLLTL
SGKVTETQQVLASQTTFRLRTPDLSITPLGEAVVGKEMAAKITFTNPLPRTLKDVVFRVE
GLGLQQGHEVFVGDIGGHATATVTEHFIPTQPGPRKLVASLDCKQLTQVHGVADINVLEQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtgaacggctgacagtaagaggcacgtcagatgttgggcgtttccctggatca
gccccacccatcagggtggagctgaccattcagaaggaggaggagaagaaacaagaggag
ggaggctgtcttggctggttcaggaagatgtgcccatgctgctgtaaacgccagaatagc
acctcctatgacattacagataaggtagaatttataaaatccccagagccagagctcatc
aagccaaagcctgagaatggagaagcaaaggaaatggaagaaatgaggttgtccctgtgt
tcagtggacctactgagctccaagacaggtcggaacagactggagcaccacacagacctg
taccacggagatgatctgatcatccgcagaggacagaccttccagatagagctagagctc
aacaggcccttctgtgctgacactgacaagctgcttttggacttgaaaacgggttccctg
cccatggtgtccaaaggcacccatgtcattattcctgtggtggatcacctggaggacgaa
cgctgggaggccaaaatagtagagcagaacggcaacaagatcaagctgtctgtcaactct
ccagccagtgctgtgatcggtctgtatgggctctctgtaacgatctcctctctgaaggat
gggcctgcaaatactcacaactccaacaagaacatcatcatgcttttcaacccttggtgt
gaagaggacacagtgttcctggatgagcaggacgagaggaaggagtacgtgctgaatgac
attggaaggatttactatggcacagagaatcaaattggtgcacgcacctggaattttggg
cagtttcatgagggaattctagatgcgtgcctgtttgttctggagaagagtgacatgcct
ccatctggtcgacgggatcctgtcaatgtagtcagggttatttctgctatgataaatgct
caggatgactttggggttctggttgggaactggtctggcaattactctgatggagtctca
cctgcagcgtggagcagcagtgtggagatcctgaggaaataccactccaccaatggaacg
cctgtgtcgtatggccaatgctgggtcttctctgcggtcactacaacagtgctccggtgt
cttggcataccgacccgcagtgtgaccaacttccaatctgctcatgataccgacacatcc
ctcactacagatgtgtatttagatgagaatatggagccgattgactacctcaatagtgac
tctgtctggaatttccacgtctggaatgactgctggatggccagactagacctgcctcct
ggtcatggaggatggcaggctattgattccactccccaggagacaagccagggcactttc
cgctgtggccccgcctctgtcaacgccatccgctccggccatgtctacctcaaacatgac
acacctttcatctttgcagaggttaacagtgataagatttactggcagagaaacctggat
ggtactttcagccagatctacgctgagaagaaggctgtcggccactacatcagcaccaaa
gcagtgggctctgacgagcgggccgacatcacacacctgtacaaacatgaagaaggttct
gaagaggaacgtatcgctgtggagactgctagtcgctatggcagcaagccaaatatctac
tctacacctatggcagaggacgtgaatgtggaggtgaggatggcgggcgagggacccagg
atgggtggcgacgccaagctgagcatcttggtgaagaacctgagctcgcagcctcgtcgg
accactctgcatagccaggtggctgtcatgtactacactggtgtgctgaagggcaccata
aagaaagaggagctacctgtggagcttatgcccaatgaagaaaaatccattgagtgggtg
ctgccctaccagcagtaccaaaaccagctggtggaccaggcagcgctattgctaaccctc
tctggaaaagtcactgaaacccaacaagtgttagccagccagaccactttcaggctccgt
acacctgacctcagtatcacgcctttgggagaagctgtggttggtaaggagatggcagcc
aagatcaccttcaccaaccctctgccgcgcacactgaaggacgtggtgttcagagtggag
ggcctgggcctgcagcagggccatgaagtgtttgtaggtgacattggtggtcacgccaca
gcgacggtaacagagcacttcatccccacccagcctggacccaggaagctggtggcatct
ctcgactgcaaacagctcacacaggtgcacggagtggctgatataaatgttcttgaacaa
tga

DBGET integrated database retrieval system