KEGG   Monopterus albus (swamp eel): 109963137Help
Entry
109963137         CDS       T05607                                 

Definition
(RefSeq) uncharacterized protein LOC109963137
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109963137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109963137
Enzymes [BR:malb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109963137
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109963137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109963137
NCBI-ProteinID: XP_020461100
LinkDB All DBs
Position
Unknown
AA seq 1982 aa AA seqDB search
MDGCTRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPLPEIRRWGNLKETLLRFQRTR
DFSATFEALTVGELAGDYFNSLGSHRQELLRQHVYRYLSAFLLDSGVKLESCDRYSSETN
GAKITSTRHWFAGERVEVLLGCIAELSPADGTVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFVPSEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHRGKQPECEETKDSVGQKYRLRERYLRHHREKGHFPAKPIIPGIHSGIFKAIPSRN
SFTQQMRRNALKNRKLSQTKKWRREKHRRSGKHPLKSSTVNQRQTVPFLSQVTLRDLKIS
VRRHSVDFLISCKDPNSKERALLQQLEAVKPKDNRLRELNLTPEESNSSSEVNLKPFTLN
SSMSVHQKNTPAVSSAGPNGKSVKIVDRQAVHMRTSSRTRSTVHTTLTHQTTNTTTMCHS
AKTDKTSSAIKQEKIEKETTESQTDKCCGAQSCIIDVAQNPAVEQAENKPIGALPFLDVG
RSVTDGSKKARDTPPISLKQYLTVNLTRLSVPQSVETENTSEDRNGRVEVRQRGRRSKCP
RSAALTVQSEKRVSRFQQRQGGGLETGTAEGNRGVREMFFKAIDKVNAKEQHPSETAGDL
SHSENRGNDKVIEIQTVPEEEKSCVQKEQQDIEIGKNERLKEKRNVASVDMKCNSKRSLE
EVKESECKIVSSEKTTGQNNIQSVKIKVKDACKEEVVAELSEQTGRSLSKQPIGRHEEDI
VIKQAKVLLSDIFKKDKPLRDEGLEGDIVGRASSPLTSKEMQNAEGGAEVSEINGGRCQS
SVQRRIMRRRKIGPRALKTKAEGKQSTKRHLSQDVPAKTELSEDSLPLQSLGHNDSLATC
LKPLPHKSKATTTLHPDTNPQALMQSNIPLKKRTFRSSVETDSEQGLTSALEQASKEATE
LNSLTVPSRDLNQGTVESSRVRRETKSKCRRSALQSVTPKRTMKQNSLNRVLHSRSNEAL
RGHLLRKGRKRKAEGQDEDDANKLGEDKQACPAAIQEQCDKDPDKYQAKDEGKRLNQQSD
LEDTKSGLNFKIRFKRRRGKVWEMQRAGIENMTLKSEKRDELVVCDPFKAIMDSVSVLNM
EMEAAQAHVQASKKSKSRLHRLKKRGEKLSERQALYFSSGTKSGKVQDLKNVENACKTSL
STRDNVEKKVKHDGELQVGVGQLPEKMESLKNERESFTAACLETKTEDSFLKSCCVMETG
SQQKEEPELDLNGLPLPVIKLRRKIEDIWEVDSKEELIQTELKVEPKVKKDVKGHILAKE
KKESRDCCKLKDECPPSQRPNSNPAVLKTEPPPFSLSLSPLSLSSPLNDSKTEAISQAAD
RITERPDMNSGGRKQRHKMERTRNCGPVETPTTCLSHTLQQIDNSLSRLSEGLCSSQTLE
KPAICTNASVIQPPSQSPPFTTADSILSSEPSFTNCCDDILDFQCLNFEGYYQPQNILPS
SPSDLCSLDPPTDPFSSPLSHSPSDTWTTETPYLGPPSPGNNFTSEDLQFFPGLISSKSD
SVPLECEVKDTSRDRSAPNPSFSFSVLSNSDLTAKDRIMTKNPGMKLSKEELRTQSLPVV
GKSRLLGATSSSLTSQNSATQPSINLKPSTSQSKAQTNLKTQGPFHRMSIPNKSHSFLGS
QPNTVRGVSQSCLTKPVPSSQLPNKFLSPQLFTVKNQNPPDNPFNFQTSTAIHRVLKYQG
GNQSQNLYSAPCKDITAAGSPMVMSRTLGAKSGAIAKTQHSQKRSFNVDSHHKGDVSVQG
FGKDMAHLGSSSNPSRSSSHFNKLNTAFPQSFAKSKMSPDKSDETNMTYKNFSTLPRPFF
FPSKVSEGYSSPQDKRSTPLTSDKNQPCYSQQDPFDFSFGSSLSSVSQHNSPQAAHSTPP
GLKSQDEHYRKDMQQQCQPGEHHGAPHCGPVPSSHSMGATKPKRVRLVVTDGTVDLDLQY
SD
NT seq 5949 nt NT seq  +upstreamnt  +downstreamnt
atggacggatgcactagaatgagtgtgaaggagctgtgtgagactgatgatctggccacc
agtttggtgctggacccactgctgggcttcagcacccacaaaatgaacatcagccccctg
cctgagattcggcgatggggtaatcttaaagagactctgttacgctttcagcgtacacgt
gacttcagtgcaacatttgaggcactgacagtgggtgaactggctggtgactacttcaat
tctttgggaagccatcgacaggaactgctgagacaacatgtctatcgctacctcagtgcc
ttcctgttggatagtggtgtcaagctagagtcctgtgacagatactcctcagagaccaat
ggagcaaagataacctcaacaaggcactggtttgctggagagcgggtggaggtcctgctg
ggctgtatagctgagctgagccctgctgatggcactgtgctgagagcaggagtcaatgac
ttcagtgtgatgtattccacacgcaagcgctgcgctcaactctggctcgggcctgcagct
ttcattaaccatgactgcaaaccaaactgcaagttcgtccctagtgagaagaatatcgct
tgtgttgaagtgattcgacccatctcacctggggaggagatcacatgttactatggtgcc
agcttttttggcgaaggcaatgaaatgtgtgaatgctgcacctgtgagagaaatggagag
ggtcacttcaaacacagagggaaacagcctgaatgtgaagaaacaaaggactctgtgggc
caaaagtaccgcctgagagaaagatatcttcgtcatcacagagagaagggtcactttcct
gccaagccgattataccaggaattcactcaggtatctttaaagccatcccctcaagaaat
tcctttacccagcagatgaggagaaatgcattgaagaacagaaaacttagtcagacaaag
aagtggagacgagagaagcacagaaggtcaggaaaacaccctttgaaatcctccacagtc
aaccagcgtcagacagttccatttttgtctcaagttacgctgagggacctcaaaatcagt
gtacggcgccactcggtggatttcttaatcagttgcaaggatccaaacagcaaggaaagg
gccttgctgcagcaactggaggcagtgaagccaaaagataacaggctgagagaactgaat
ttaactcctgaggaaagtaacagtagtagtgaggtaaacttaaagccttttactctaaat
tcctccatgtcagttcatcagaaaaatacacctgcagtaagttctgcaggtcctaatggc
aagtctgtcaaaattgtggacagacaagctgttcacatgaggacctcttcaagaacaagg
agcacggttcacaccacgctcacacatcagacaactaacactacaactatgtgtcactct
gctaagactgacaaaacctctagtgcaataaaacaagagaagattgaaaaagaaaccaca
gaaagtcaaaccgacaagtgctgtggtgctcaatcttgcatcatcgacgtggctcaaaat
ccagctgtggagcaagcagagaataagcctatcggagcattaccctttttagatgttggt
cggagtgtcacagatggatcaaagaaagccagggacactccaccaatatcactgaagcaa
taccttacagtcaacctaacaaggttatcagtgccacaaagtgtagaaacagaaaatacc
tctgaagacagaaacggaagagtggaggtgagacaaaggggcaggcggagcaagtgtcct
agatcagcagctctgacagtacagtcagaaaaaagagtgtccagatttcagcagaggcag
ggaggaggattggagactggcacagctgaaggtaacagaggggtcagggaaatgtttttc
aaggccattgataaagtaaatgcaaaagagcaacatccaagtgaaactgcaggtgattta
tcccacagcgagaacagggggaatgacaaagttatcgaaatacaaaccgtgccagaagaa
gaaaaaagctgtgtacaaaaggagcagcaggacattgaaataggcaaaaatgaaaggcta
aaagaaaagagaaatgttgcatcggtggatatgaaatgtaatagtaagagatccttagag
gaagtgaaagagtctgaatgtaaaatagtgtccagtgaaaaaactacagggcaaaataac
atccagtctgttaaaattaaagtcaaagatgcatgtaaggaggaagtagttgctgaactg
tcggaacaaacgggtaggagcctgagtaagcagccaataggtaggcatgaagaagatatt
gtcataaagcaggcaaaggttctgctatctgatatttttaaaaaagataagcccttaaga
gatgagggattagagggagatattgtaggaagagcctcttctcctttgacctctaaggaa
atgcaaaatgctgaggggggagcagaagtgagcgaaattaatggaggcaggtgccaaagt
tcagtgcagaggaggattatgagaagacgaaaaattggacctagagcactaaagacaaaa
gcagaaggtaagcaaagcaccaagagacacttgagccaagatgttccagctaagactgag
ttgagtgaggatagtttgccacttcagtcactggggcataatgactcgctggccacctgc
ctcaaaccactacctcataagtcaaaagctacaactactctgcatccagacaccaatccg
caggcactcatgcagtccaacatacctctgaagaaacgcacatttcgcagttctgtggaa
actgactctgaacaaggtttgacttctgctttggaacaagcttctaaagaagctactgaa
ttaaattcattaacggtgccgagtcgggaccttaaccagggtacagtggagagtagcaga
gtgagaagagagactaaaagcaaatgtagaagatcagcacttcagagtgtaacccctaaa
aggaccatgaaacaaaattccttgaacagagtgcttcactccagatctaatgaagctctg
cgaggacatttactgaggaaaggccgaaagcgtaaagcagaggggcaagacgaagatgat
gctaataagcttggagaggacaaacaagcttgtcctgctgcaatccaagagcagtgtgat
aaagatccagataaatatcaagcgaaagatgaagggaaaagattaaaccagcaaagtgat
ttggaggacacaaagtcgggccttaattttaagattcgtttcaaaagaaggagggggaaa
gtatgggagatgcaacgtgctggaattgaaaatatgactttaaaatcagagaagagagat
gaattggttgtatgtgatccttttaaagccatcatggattctgtatcagttttaaacatg
gagatggaggcagctcaggctcatgtgcaggctagtaagaagtcgaagagcagactgcat
cgtttgaaaaaaagaggtgagaagctgagtgaaaggcaagctttatatttctcctcaggc
acaaaatcaggcaaagtccaagaccttaaaaatgttgaaaatgcatgcaaaaccagtcta
tctactcgagacaatgtagaaaagaaagtgaagcatgatggggagcttcaggtgggagtc
gggcagctgccggaaaaaatggagagtttgaaaaatgagagggaatcttttacagctgct
tgcctggaaacaaaaactgaagatagttttttaaagagctgctgcgtgatggaaactggg
tcacaacagaaagaggagcctgagctggatttaaatggtcttccgttaccagtaattaaa
ctacgcagaaagattgaggatatttgggaagtggacagcaaagaggagcttatacaaact
gagcttaaggtagagcccaaagttaaaaaagatgtgaagggtcacattttagcgaaagaa
aagaaagaatctcgtgattgttgcaaactcaaagatgagtgcccaccctctcagaggccg
aacagcaaccctgcagttctgaaaacagaaccaccaccattttccttgtctctttcacca
ctctctctgtcttcccctcttaatgacagtaaaactgaagctatatcccaagctgcagat
agaatcactgaaaggccagacatgaacagtggaggaaggaagcagaggcacaaaatggag
agaacacgcaactgtgggcctgtggaaacacccaccacttgtcttagtcacactctccaa
caaattgacaatagcctctctaggctctctgagggcttgtgttcatctcagactttggaa
aagccagcgatctgtaccaatgcatcagtcatccagcccccctcccagtctcctccattc
acaactgcagatagcatactttccagtgagccaagcttcacaaactgctgtgatgatatt
ttggactttcagtgtctcaactttgagggatattatcagccacagaacatacttccatct
tctccatctgatctctgttcactggatccccccacagatcctttcagcagtcccctctct
cacagcccatctgatacatggaccactgaaacaccataccttggccctcccagtccagga
aataactttaccagtgaagacctgcagttttttccaggtttaatttcttccaaaagtgat
tctgttcctctggaatgtgaagtgaaggatacctccagagacagaagcgcacccaacccc
agtttcagtttttcagttctcagcaactctgacttgaccgccaaggatcgaattatgact
aaaaatccaggaatgaaactgtccaaagaagaactcagaactcagtctttgcctgtagtt
ggcaagtctcggttgttgggtgcaacatcatcttctcttacatctcaaaattctgctacc
cagccctccatcaacctcaagccgagcaccagccaatcaaaagcccagactaaccttaaa
acccagggccctttccaccgtatgagcattcctaataaatcccattcttttctaggtagt
cagccaaacacagttagaggagtgtcccagagctgcttaactaagcctgtcccgtcatct
cagttgcctaacaaattcctctctcctcagctcttcactgtgaaaaatcagaatcctcct
gacaatccattcaacttccaaacctctacggctattcacagggtgcttaagtatcagggg
ggtaaccagagtcagaacttgtatagtgcaccttgtaaagacatcacggctgctggcagc
ccgatggtcatgtccagaacacttggtgcaaaatcaggtgctattgcgaaaacacagcac
agtcagaaacgcagttttaatgtagacagtcatcataaaggcgacgtttctgttcagggg
tttggaaaggatatggctcatcttggttcttccagtaaccccagcagatccagctctcat
ttcaacaaactcaacactgctttccctcagtcttttgctaaaagtaagatgtcacctgac
aaaagcgatgaaacaaacatgacttacaaaaacttttctacgttgccaagacccttcttc
tttcctagcaaagtgtctgaggggtattcatcaccacaagacaagagatccactccactg
acctcagacaaaaaccagccttgttacagtcagcaagatccttttgatttcagttttggc
tcatctctgtcttcagtgtcacagcataacagcccccaggctgcccacagtacaccacct
ggcctcaaaagtcaggacgaacattacaggaaggacatgcagcaacagtgccagcctggg
gaacaccatggtgccccacactgtgggcctgttccatcatctcactccatgggtgctaca
aaacctaagagggtgaggttagttgtgacggatggcacagtcgacttagatctccagtac
tctgattaa

DBGET integrated database retrieval system