KEGG   Monopterus albus (swamp eel): 109963664Help
Entry
109963664         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:malb01002]
    109963664
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109963664
   04090 CD molecules [BR:malb04090]
    109963664
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109963664
Peptidases [BR:malb01002]
 Metallo Peptidases
  Family M2
   109963664
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109963664
CD molecules [BR:malb04090]
 Proteins
  109963664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 109963664
NCBI-ProteinID: XP_020462022
LinkDB All DBs
Position
Unknown
AA seq 1290 aa AA seqDB search
MATGVDRFLCSVLLLLPALCLSVALPESWLPGEYKNTVDDALRFLDDYNSTSEEVLFSSV
SASWDYNTNLTDYNSERQVNASLEEQAFSEAWGLKAKTVFTSEVLNGLPDTKDKNLMEKI
KILGAANLPQQDRERYNTILSTMDKIYSTAKVQPEPNISWNLEPELTKIMANSTSYKTLL
YAWEGWHNNSGVPLKQYYPKFVELSNKASQADGFADTGADWRSWYETATFEDDLEKLYRT
IEPLYQHLHAFVRRQLYNHYGPKYINLKGPIPAHLLGNMWAQTWNNIYDMMIPFPDKPSL
DVTGEMEKQGYNATHMFRVAEEFFTSLGLEPMPQEFWDKSMLEKPEGREVVCHASAWDFY
NRKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGFRRGANPGFHEAIGDVLSLS
VSTPKHLHKIKLLESVTSDPETDINYLLKMALEKIAFLPFGYLIDQWRWSVFSGHTPPDQ
YNSQWWHLRTKYQGICPPTKRTEDHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEALCKA
ANHMGPLHTCDIYQSKEAGAILKKVLQAGSSTPWPIVLQEAIGTNKMDASSLMKYFDPVI
QWLKVQNVNETLGWPDFKWVPPIPEGYPEDIGKNTEEVEAKKLLDEYNRTAEVVWNAYTE
ASWTYNTDITENNKQKMLEKNLEMAAHTLQYGKKARQYDTTDFQDASVKRIIKKLSDIER
AALPTAELEEYNTLLSNMETKYSVAEVCRDDGKCLPLDPDLQKIMAESRNYDELLFAWKG
WRDAAGRAVRQDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEEDLEALWKELSPLY
QDLHAYVRRALYNKYGPKYINLNGXPAHLLGNMWAQTWSGIMDLAMPYRNATQVDATPAM
VAQGWNPIRMFNESDRFFTSLGLLPMPEEFWKKSMLEKPSDGRQVVCHASAWDFYNRKDF
RIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPK
HLHSIGLLDKVENNYESDINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRIPPTEYNKEW
WNLRLKYQGVCPPVSRTEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHKALCEAAKHVG
PLHTCDIYESKEAGKLLGDVMKLGFSKPWPEAMTMITGQPKMSAQPLIQYFKPLIEWLEK
ENNKNKEIRGWPAYDWKPSEAEESKVDDKVDNNVDFLGMSVDNSAAAAGQWILLVLGVVL
LVATILLAYKYRKTKKSPKSTSMMELKQKD
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atggccactggtgtggacaggtttttgtgctctgtgctgctgctgctgccagcactctgt
ctgtctgtggctctgccagaaagctggctgccaggggaatataaaaacactgtggatgat
gcgctgagattcctcgacgactacaacagcacttctgaagaagtgttattctccagtgtc
tctgccagctgggactacaacaccaacttaacagactacaactctgagcgccaggtaaat
gcatcccttgaagagcaggccttttctgaagcctgggggctaaaggccaagacggtcttc
acttctgaggtcctcaacgggctccctgacactaaagacaaaaacctgatggaaaagatc
aaaatactgggagctgccaacctgccccagcaagacagagagaggtataacaccattctc
agcaccatggacaagatttattctacagctaaggtgcagccagagccaaacataagctgg
aacctggagcctgagctcacaaagatcatggccaactccacgagctataagacgctgctg
tatgcctgggaaggctggcacaataattcaggtgttcctctcaagcagtactaccctaag
tttgtggagctcagcaacaaagcctctcaagctgatggatttgctgacacgggagcagac
tggcgctcctggtatgagactgcgacctttgaggacgatttagagaaactctaccggacc
attgagcccctctaccagcacctgcatgcctttgtgcgacgccagctctacaaccactat
ggtcccaagtacatcaacctcaaaggacctatccctgcccacctgctaggaaacatgtgg
gctcagacctggaataatatttatgatatgatgatcccatttcctgacaagcctagcttg
gatgtgactggtgaaatggagaaacaaggctataatgccacgcacatgtttcgcgtggct
gaggagttcttcacttctctgggtttagaaccaatgcctcaggagttctgggataaatcc
atgctggagaagcctgaaggtcgagaggtggtgtgccatgcatctgcatgggacttttac
aatcgcaaagacttcaggattaaacagtgcaccacagtgacaatggagcagctcttcact
gtgcaccatgagatgggacacatccaatattacctgcagtacaaggatcagcctgtgggc
ttccgtcgcggagccaaccctggttttcacgaggctattggcgatgttttatctctctct
gtttccacacccaaacatctgcacaagattaagctgctggaatctgtgacctctgaccct
gaaaccgatatcaactacctgttaaagatggctctggagaagatagccttccttcctttt
ggctacctcatagaccagtggagatggagtgttttcagtggacacactcctccagaccag
tacaactcacagtggtggcatctcagaacaaaatatcaaggcatctgcccacccacaaaa
cgtactgaggatcactttgatcctggagcaaaataccatatccctggaaacacgccatac
atcaggtattttgtcagcttcatcctgcagttccagtttcatgaagcactgtgcaaggca
gccaaccacatgggtcctttgcacacatgtgacatctatcaatctaaagaagcaggcgcg
attttaaagaaagttcttcaggctggttcttccacaccttggcctattgtgctccaggag
gctatagggaccaacaagatggatgccagctcactgatgaaatactttgaccctgttatt
cagtggctgaaagttcaaaatgtgaatgagaccttgggatggcctgacttcaagtgggtc
ccaccaatccctgagggctaccctgaagatattggcaaaaatacagaagaggttgaggca
aagaagcttctggacgagtacaacaggacagctgaggtggtgtggaatgcctacactgag
gcctcctggacatacaacactgacatcaccgaaaataataagcagaagatgcttgagaag
aacctggagatggcagcacataccctgcagtatggaaagaaggcccgtcagtacgacacc
actgacttccaggacgcctcggtcaaacgcatcatcaaaaaactcagcgacatcgagagg
gctgcactgcccacagcagagctggaagagtacaacactctcctgtccaacatggagacc
aagtacagtgtggctgaggtctgcagagatgatgggaaatgcctcccgctggatccagat
ctccagaagataatggcagagtcaaggaattatgatgaactgttgtttgcctggaaggga
tggagagacgctgctggaagagcagttcgtcaggactacaagagatatgttgagctggct
aacaaagccgccacactcaatggtcattctgacaatggggctttctggcgctccttgtat
gaaacccctacttttgaggaagacctggaggctttgtggaaggagctgagcccactctat
caagacttacacgcctatgttcgcagggctctgtacaacaagtatggtcctaagtatatc
aatctgaatggcnntcctgctcatttgctgggcaacatgtgggctcagacatggtctggc
ataatggacttggccatgccctaccgaaatgccacacaggtcgatgccacaccagctatg
gtggcacagggctggaatcccatcagaatgtttaatgaatcagacaggttttttacctcc
ctgggcctgctaccaatgccagaagagttctggaagaagtccatgctggagaagccgtct
gatgggcgccaggtggtgtgccacgcctctgcatgggacttctataaccgaaaagacttc
aggatcaagcagtgcactgttgtaactatggatgacctgatcactgtgcatcatgagatg
ggccacgtccagtacttcctgcagtacaaagaccaacctgtgtccttccgtgatggagcc
aaccctggcttccatgaggccatcggtgacgtgctagcgctttctgtctccactcccaaa
catctgcacagcattggcctcctggacaaagtcgagaacaactatgaaagtgatatcaac
ttcctgatgagcattgcacttgacaagatcgccttcctaccttttggctacctgatggac
cagtggagatggaaggtatttgatggacgcatccctccgaccgaatacaataaagaatgg
tggaacctcagacttaagtaccagggagtgtgtccacctgtatcccgaactgaagaagac
tttgacccaggtgcaaagttccacatccctgctaatgtaccctatgtcaggtactttgtc
agcttcatcatccagtttcagttccacaaggctctttgtgaagctgccaaacatgttggg
cctcttcatacctgtgatatttatgaatcgaaggaagctgggaagctactgggtgatgtg
atgaagctcggcttcagtaagccctggcccgaagcaatgaccatgatcaccggccagccc
aaaatgagtgcccagccactcattcaatatttcaaacccctcattgagtggctggagaaa
gagaacaacaagaacaaggaaattcgcgggtggcctgcgtatgactggaaaccaagtgaa
gctgaagaaagtaaagtggacgataaagtggacaataatgtggacttcctgggtatgagc
gtggacaactcagctgctgcagctggccagtggatcctgctggtccttggcgtggtcctc
ttggtggccaccatcctcttggcctataagtacaggaagacaaagaagtctccaaagtcc
acgtccatgatggagctcaaacaaaaggactag

DBGET integrated database retrieval system