KEGG   Monopterus albus (swamp eel): 109963965Help
Entry
109963965         CDS       T05607                                 

Definition
(RefSeq) catenin beta-1-like
  KO
K02105  catenin beta 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04310  Wnt signaling pathway
malb04510  Focal adhesion
malb04520  Adherens junction
malb04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109963965
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109963965
   04520 Adherens junction
    109963965
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109963965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ Atx10homo_assoc Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 109963965
NCBI-ProteinID: XP_020462585
LinkDB All DBs
Position
Unknown
AA seq 768 aa AA seqDB search
MATQSDLMELDMAMGDSKAAVSQWQQQSYLDSGIQSGVTTTAPSLSGKGNPDAEEDDPTL
YDWEFNQPFTPEATDIEGYAMTRAQRVRAAMFPETLEEGLQIPPTQLDAAHPTAVQRLAE
PSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHA
LMRSPQMVSAVVRAMQNTGDVETARCSAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSP
VDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLSNTNVKFLAITTDCLQILAYG
NQESKLIILASGGPQALVNIMRTFTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALG
LHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNL
TCNNYSNKLMVCQVGGIEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRL
HYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHSALREQGAIPRLVQLLVRAHQDT
QRRTSMGGNQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPV
ENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKP
QDYKKRLSVELTSSLFRTEPMAWNETGDLGLDMGAQGDPLTYRQDDGAYRAYPAAYGQDT
LLDPMMEGADYHADALPDLGHHTDPLPDLGHTQDLMDSNQLAWFDTDL
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggctacacagtctgatttgatggagttggacatggcaatgggagacagtaaggctgct
gtcagccagtggcagcagcagtcctacctggactcaggcatccagtctggagttaccacc
actgcaccatctctgagtggcaaggggaaccctgatgctgaggaggatgatcccaccctc
tacgactgggagttcaaccagccctttactcctgaggccacagacatagaggggtatgcc
atgacccgggcgcagcgtgtgcgtgctgccatgttcccagagaccttggaggagggcctc
cagatcccacctacccagctggatgctgcccaccccacagcagtgcagcgcttggcagag
ccctctcagatgctgaagcatgccgtggtcaacctcattaattatcaggatgatgctgag
ctggccacacgtgccattcctgagcttaccaaactgctcaacgatgaggaccaggttgtt
gttaacaaggcagccgtaatggtgcatcagttgtccaagaaggaggcttcgcgccacgcc
ctcatgcgttcgccacagatggtttcggctgttgtacgtgccatgcagaacaccggtgat
gtggagacagcacgctgctctgctggcactttgcacaacctttcccaccatcgtgagggg
ctccttgctatcttcaagtctggaggcatccctgccctggtcaagatgctgggttcacca
gtggacagtgttttgttctacgccatcaccacgctccacaacttgttgttgcatcaggaa
ggggccaagatggcagtgcggctggctggaggactacagaagatggtagccttgttgtct
aacactaatgtcaagttcctggcaatcactaccgactgcctgcagatcttggcatatgga
aaccaggaaagcaagctgatcattctggccagcggcggcccccaggcactggtcaacatc
atgaggaccttcacgtatgagaaactgctgtggaccacgagcagagtgctcaaggtgctc
tctgtttgttcaagcaacaagcctgccattgtagaagctggtggcatgcaggcattgggg
cttcacctgacagaccctagccagcgtctggtccagaactgtctctggactttgaggaat
ctttcagatgctgccactaaacaggagggaatggaaggtcttctggggaccctggtccag
ctgctgggcagtgatgacatcaatgtggtaacatgtgctgctggcatcctctccaatctg
acctgtaacaactatagtaacaaactcatggtctgtcaggttggaggcattgaggctctg
gttcgtacagtacttcgggctggtgacagagaagacatcacagagccagcagtctgtgcc
ctacgccacctaacctcccgccaccaggatgcggagatggcccagaatgctgtgcgcctt
cattatggcctgcccgtggtggtcaaactactgcaccctccatcccactggccactaatc
aaggccacagttggtctgattcggaacctggctctttgccccgccaaccacagtgctcta
cgagaacagggagccatccctcgcctcgtccagctgcttgtcagagctcaccaggacacc
cagaggcgcactagcatgggaggcaaccagcagcagtttgtggagggtgtccgtatggag
gaaatagtggaaggctgcacaggagctctgcacatcctggcccgggatgtccacaacaga
attgtcatcagagggctcaacaccattccactctttgtccagttgttgtattctccagtg
gagaatatccagcgtgtggcagcaggtgtgctgtgtgaactggcacaggacaaggaagct
gctgaggcaattgaagctgaaggagccactgcaccgctcactgagctgctgcactcccgt
aatgagggtgttgcaacctatgctgcagctgtcctgttccgcatgtctgaggacaagcct
caggactacaagaaacgtttgtcagtggagctgaccagctctttgttcagaaccgagcct
atggcctggaatgagactggagacctcggtctggatatgggagctcagggagaccctctg
acttacaggcaagatgatggagcataccgggcctacccagcagcttatgggcaggacacc
ctgttggacccaatgatggaaggtgctgactaccatgctgatgcgctgcctgatctgggt
caccacacggacccgttgccagaccttggccacacccaggacctgatggacagcaaccag
ctggcctggtttgacactgacctgtag

DBGET integrated database retrieval system