KEGG   Monopterus albus (swamp eel): 109964187
Entry
109964187         CDS       T05607                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04217  Necroptosis
malb04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109964187 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109964187 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109964187 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109964187 (stat3)
Transcription factors [BR:malb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109964187 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 AAA_18 AP1AR Syntaxin-6_N
Other DBs
NCBI-GeneID: 109964187
NCBI-ProteinID: XP_020462954
LinkDB
Position
Unknown
AA seq 784 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SAAQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAVPEPEMGGDSTSTIQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGHLDSLTLDMDV
ASPM
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacaacagctggaaaccaggtatctggagcagctctatcac
ttgtacagcgacagcttccccatggagctacggcagtttcttgccccctggattgagagt
caggactgggcttatgctgccaataaggagtcacatgccacactggtgttccacaacctc
ctgggagagatagaccagcagtatagccgtttcctgcaggagaacaatgtactttaccaa
cataacctgcgcaggattaaacagcacctgcagagcaagtatttggagaagccgatggat
attgcccgcattgttgcccgctgcttgtgggaggagcagaggctcctgcaaactgccact
tctgctgcacaggatggtcaggcagcccatcccactgggacagtagtgacagagaagcag
cagatcctagaacacaaccttcaagacatcaggaagcgggtacaggatatggaacagaag
atgaaaatgcttgagaacttacaggatgattttgacttcaattacaagacactgaaaagc
caaggagagttgtcccaggacctaaatgggaatagccaggctgctgctaccagacagaag
atggctcagcttgagcagatgctgagcgccctggaccagctcaggaggcaaattgtgaca
gagatgggaggcttgctgactgccatggactatgtgcagaaaaacctaacagatgaagaa
ctagcagactggaagagaagacagcaaattgcctgtattggaggcccacctaacatctgc
ctggaccgcctggaaacatggatcacatctttggctgagtcccagcttcagatccgtcag
cagatcaagaagttggaggaacttcaacagaaggtgtcctacaaaggagatcccatcatt
cagcaccgtcctgctctggaggagaagattgtggacttgttcagaaacctcatgaagagt
gcttttgtggttgaaagacagccttgtatgcccatgcacccagacagacccctggtcatc
aaaacgggagtgcagttcacaaataaagtcaggttactggtaaagtttcctgaactcaat
taccagctgaaaattaaagtttgcatcgacaaagaatctggggatgtggctgcaattcgg
gggtcacgaaagtttaacatccttggcaccaacacaaaagttatgaacatggaagaatcc
aataatggcagcctctcagcagagtttaaacacctgaccttgagagaacagaggtgtggt
aatggtggacggactaatagtgatgcctctctgattgtcacagaggagcttcatcttatc
actttcgagacagaagtttatcaccaaggtctgaagatagatctggagacacattccctg
cctgtggtagtcatttcaaacatctgccagatgcccaacgcctgggcttccattctttgg
tacaacatgctcactaaccacccaaagaatgtgaacttcttcaccaagcctccagtgggt
acatgggaccaggtggctgaggtgctaagctggcagttctcctccaccactaagagaggc
ctgaccattgagcagctcaccactctggctgagaaattactagggccttgtgtgaactac
tctggctgtcagatcacctgggccaagttctgcaaggaaaacatggctggcaagggcttc
tccttctgggtgtggctggacaacattattgacctggtaaagaagtatatcctggctctg
tggaatgaggggtatataatgggatttatcagtaaggagagggagagagccattctgagt
ccaaaacctcctggtacatttctgctgcgctttagtgaaagcagcaaggagggaggcatt
acatttacatgggtagagaaagacatcagtggaaaaactcagatccagtcagtggagccc
tacaccaagcagcagctcaacaacatgtcttttgccgacatcatcatgggctataagatt
atggatgcaaccaatattctggtttcacctcttgtctacctctaccccgatatccctaaa
gaggaagctttcgggaaatactgcaggccagaagcagttcctgaacctgagatgggagga
gactctacgagcactattcagccatacctgaagacaaagttcatctgcgttaccccgtgt
ccctccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcaca
aactctggaaacaccagtgacctgttccccatgtcgcctcgcacccttgactctctgatg
cacaatgaagctgaagccaatccaggacatttggattcactcactttggacatggatgta
gcttcacctatgtga

DBGET integrated database retrieval system