KEGG   Monopterus albus (swamp eel): 109964251
Entry
109964251         CDS       T05607                                 

Gene name
bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04210  Apoptosis
malb04217  Necroptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109964251 (bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109964251 (bax)
   04217 Necroptosis
    109964251 (bax)
   04115 p53 signaling pathway
    109964251 (bax)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109964251 (bax)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109964251 (bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:malb03029]
    109964251 (bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malb02000]
    109964251 (bax)
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109964251 (bax)
Transporters [BR:malb02000]
 Other transporters
  Pores ion channels [TC:1]
   109964251 (bax)
SSDB
Motif
Pfam: Bcl-2 DUF997
Other DBs
NCBI-GeneID: 109964251
NCBI-ProteinID: XP_020463082
LinkDB
Position
Unknown
AA seq 192 aa
MASRPVGGDQENTKDQILELGAVLLKDFIYERVQRHGDSNTLVTRAQLGGGELCDPNHMK
LAQCLQQIGDELDANVELQRMINDSSLSPTKDMFMKVAFEIFSDGKFNWGRVVALFYFAC
RLVIKALVNKVPDIIRTIISWTMDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVFLA
GVLTTVLVIRKM
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcatcacggccggtaggaggtgatcaagaaaataccaaagaccagatactagaatta
ggagctgttttgttgaaagatttcatctatgagcgagttcagcggcatggagacagcaat
actttagtgaccagggcacagctgggtggaggggagctgtgtgacccaaaccacatgaag
cttgcccagtgcctgcagcagattggagatgagctggatgcaaatgtagagctccaaagg
atgataaatgactcttcacttagtcccacaaaggatatgtttatgaaagttgccttcgag
atcttctcagatggaaaattcaactggggcagggtggttgcactgttctactttgcctgt
cggcttgtcatcaaagctcttgtgaacaaagttcctgatatcatccgaactattatcagc
tggaccatggactacctccgggaacatgtgatcaactggatcagggagcaaggtggctgg
gagggtattcgttcctactttggcacacctacatggcagacagtgggggttttcttggct
ggtgttctcaccactgttctagtcattcgcaagatgtga

KEGG   Monopterus albus (swamp eel): 109967870
Entry
109967870         CDS       T05607                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04210  Apoptosis
malb04217  Necroptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109967870
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109967870
   04217 Necroptosis
    109967870
   04115 p53 signaling pathway
    109967870
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109967870
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109967870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:malb03029]
    109967870
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malb02000]
    109967870
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109967870
Transporters [BR:malb02000]
 Other transporters
  Pores ion channels [TC:1]
   109967870
SSDB
Motif
Pfam: Bcl-2 SCAMP Bcl-2_3
Other DBs
NCBI-GeneID: 109967870
NCBI-ProteinID: XP_020469392
LinkDB
Position
Unknown
AA seq 205 aa
MDDGREDEKKEGEQEPQGAVGGEDVIDDPILEQGAVILRGYVVDRINTEDPGRHVSSEDL
GGRPNELQDPQVKEVVDQLIKIADELNRNAELQQLINQVQGDCAQDIFMKVARNIFADGI
NWGRVVALFHLAYRLIYRALTSNHLDTIRTVISWVLQVIKDLLYSWLIQQGGWVGVIRGI
SRWRTVAIVASLVLVATFVYYRKTR
NT seq 618 nt   +upstreamnt  +downstreamnt
atggatgacggccgagaagacgagaagaaagaaggcgagcaggagcctcagggtgccgtg
ggtggggaagatgtcatcgatgatcccatcctggagcaaggagcagtgatcctcagaggg
tatgtggttgatcgtataaacacagaggaccctggtcgacatgtctcctccgaggatctt
ggaggaaggcccaatgaattacaggatccacaagtcaaagaagtggtggaccagctgatc
aagatagcagatgagctgaacaggaacgctgagctccaacagctgatcaaccaggtgcag
ggggactgtgctcaggacatcttcatgaaagtggccaggaacatctttgctgatggcatc
aactggggtcgagtggtggctctcttccatctggcctacaggctgatatacagggcactg
acctccaaccatctagacaccatcaggacggtcatcagctgggttctccaggttatcaag
gatctgctctactcctggctcatacagcagggaggctgggtgggcgtgatccgtggcatt
tctcggtggaggacagtagccatagtggcatcactagtattggtggcaacttttgtttac
tataggaagacacgctga

KEGG   Monopterus albus (swamp eel): 109973692
Entry
109973692         CDS       T05607                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04141  Protein processing in endoplasmic reticulum
malb04210  Apoptosis
malb04217  Necroptosis
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109973692
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109973692
   04217 Necroptosis
    109973692
   04115 p53 signaling pathway
    109973692
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109973692
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109973692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:malb03029]
    109973692
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:malb02000]
    109973692
Mitochondrial biogenesis [BR:malb03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    109973692
Transporters [BR:malb02000]
 Other transporters
  Pores ion channels [TC:1]
   109973692
SSDB
Motif
Pfam: Bcl-2 BID
Other DBs
NCBI-GeneID: 109973692
NCBI-ProteinID: XP_020479132
LinkDB
Position
Unknown
AA seq 204 aa
MACEGNGMSDERIGAALIREVIEEELKDMPTADVPPLTPVVKTEIKNEQEQKMVTQLGKM
IRIIGDRVRDDKEFQDAIDGVAQGPGSKWDKLKQVADKVFEHGITWERIAVLIYVAGKLA
VRMVEAHLPQLVRDILTWTVDFFRNNLLSWIREHGGWINSFSELATASMRSMSCMSSHYS
GLFVIFVAGLALGSLITWRMTRCP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcttgtgaaggaaacgggatgtcagatgagaggataggagctgccctgataagggag
gtcatagaggaggagctgaaagacatgccgacagcggatgtcccacccctcactccagta
gtaaagacggaaataaagaatgagcaggagcagaagatggtgacacagctaggcaaaatg
atccgcatcattggcgaccgagtgcgggacgacaaggagttccaagatgcaattgatggg
gtggctcaaggccctggctccaagtgggacaagcttaagcaagtggcagacaaagtgttt
gaacatgggataacctgggagaggattgccgttctcatctatgttgctggcaagctggct
gtcaggatggtggaggctcatctccctcagttagtgagggacatcctgacgtggactgtg
gactttttcagaaacaatctcctgagctggattcgggaacatggcggatggatcaacagt
ttctcagagttggcaacggcatccatgaggagcatgtcatgcatgagctctcattactct
ggcctctttgtcatctttgttgccggcctggctctgggaagcttgatcacctggagaatg
accagatgcccctga

DBGET integrated database retrieval system