KEGG   Monopterus albus (swamp eel): 109964259Help
Entry
109964259         CDS       T05607                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04210  Apoptosis
malb04625  C-type lectin receptor signaling pathway
malb04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109964259
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109964259
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109964259
   04672 Intestinal immune network for IgA production
    109964259
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109964259
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109964259
Protein kinases [BR:malb01001]
 Serine/threonine kinases: STE group
  Other
   109964259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109964259
NCBI-ProteinID: XP_020463094
LinkDB All DBs
Position
Unknown
AA seq 892 aa AA seqDB search
MRLEGSYYVSKLRALNCVDAAKDPADEMAVRQRIFNSTAPFSGSAQAELKGSYPSCSVAD
QETEEEEEEGKDSKMGFAQCNIYITKVLTHGTAEQVGERPVKTSTFIAQAECESQDSQEF
SPSCSERSFVPSPNCFTSSLSSERNNVACPTTASIQELSSSSALLTPRKKTRRRQKRKGK
KKQEKKKGKRRHRHRIPSGTVPEQESGSSLVQIQEELSLGGRSSLSTSCCSSTESSEEQD
RGPLLCSQQICNTRSSCSPLNWRPLGVCSYFSNPHSYEQDSDSDSHSSLGDCSLALAGLR
GSVSQGDPCYAGPFFKDVERDAREEEDELSAADSFSNEGIIFYNEKIQPVDSEYKEGREY
VLTRFIKEGSYGEVHSAQDVNTGFKFAVKKMPLERFTSEEVGAWSALRSPYVVELFGVVR
EGPNVVLLMDLKSGSLGQLIVERGRLPEDLSLHYQSQVLTALEYLVKKKVVHLDIKADNV
LLSEDGRDTFLCDFGHAERIDNQGQSLSGSKDLKGTETHLAPEIVKGEPRGAKADVWSSC
CMLLHMLNGCQPWTRYYTCRLYLKIANEPPPLREIPPDCSSLTAEIIKAGLQKDPVKRAS
ASALKEKTDRALKEIGGLTSPVKGPYTEPLYIANKPPDSLWLTSSNVEYEGEEEHQEYVE
KVITPGRRTEQPYNCDEDQEADCHEPKRGSPFCLQTLSSEPNHNKGNNISTVPELELQKL
ERDFYLSSLSQPQSAEMQEQLLSCLSSDPYSNWEPWDKKDSGRWSLSPGDDYSSGVFSCN
SQPDVQVVGMDLLSHTQLPPPCCFEGVDVCIRDFRRRSIRIRETRRVKIGHIATGISDQI
SKRVFTLETQQGQQIAHDEEVQESGLELCCVPAPDFSPGWRWRIRDGVLETR
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgcggctagaaggaagttattatgtcagtaaactgagagcgctgaactgtgtcgatgca
gctaaagatccagcagatgaaatggcggtgaggcagaggatattcaactcaacagcacca
ttctctgggtcagcgcaggctgagctgaaggggtcatacccatcttgctcagtcgctgac
caggagacggaggaggaagaagaggagggaaaggatagtaaaatgggctttgcacaatgt
aacatctacataacaaaagttctgacacatggaactgcagagcaagtgggagaaaggcca
gtgaagacctcaaccttcattgctcaggctgaatgtgaaagccaggactcccaggagttt
agtccatcttgttctgaacggtcctttgttccctctcccaactgcttcaccagcagtctt
tcctcagagcgcaacaacgtggcgtgcccaaccacagcctccatccaggagctgagcagc
tcatcagcattgctcacccccaggaagaagactaggaggagacagaagcgtaaggggaag
aaaaaacaggagaagaagaaagggaagcggcgacacagacatcgtattccttctggaaca
gttcctgaacaggagagtggaagttctctggtccagatccaggaggagttgtctcttgga
gggagaagcagcctcagtacttcttgttgtagcagcactgagagctcagaggagcaggac
agagggcctcttctctgcagtcagcagatctgcaacacacgctccagctgctctcctctg
aactggaggccactgggagtctgcagctacttctccaatccccattcctatgagcaggac
agcgactcagactcccacagcagtctgggagactgctcgctggctcttgctggcctcagg
ggcagcgtcagtcagggggacccttgctacgcagggccctttttcaaagatgtagagagg
gatgcaagagaagaggaagatgagctctcagcagctgattctttcagcaatgagggaata
atcttttacaatgaaaaaattcagcctgtggactctgaatacaaggaagggagggagtac
gtccttacacggtttatcaaggaaggctcctatggcgaagtacacagtgctcaagatgtc
aacacaggcttcaaatttgctgtcaaaaagatgccactggagaggttcaccagtgaggag
gtgggtgcgtggagtgccctcagatctccttatgtggtggaactcttcggagtggtcaga
gagggacctaatgttgtccttttgatggacctcaaatctggctccctgggccagttgata
gtggagcgtggtcggctgccagaggatctaagtctccactaccagtcacaagtcttaaca
gcgctggagtacttggtaaagaaaaaagtggtgcatctagatattaaagctgacaatgtg
ttgctgtcagaggacggtagagacacctttctgtgtgactttggacatgcggagagaatc
gacaatcaggggcagagcctcagtgggtccaaagatctgaagggaacagagacccatctg
gcacctgagattgtaaaaggggaaccccgcggagccaaagcagatgtgtggagcagctgc
tgtatgctactgcacatgctcaatgggtgtcagccttggacaagatactacacctgtaga
ctttacctgaagattgctaatgagccaccgcctctgagagagatcccacctgactgtagc
tctctcacggctgaaataataaaagcaggtctccagaaagatccagtcaagagagcatca
gcatctgccctgaaagaaaaaactgacagagccctgaaagaaattggagggctcaccagc
ccagttaaggggccctacacagagccgctgtacattgccaacaaacctccagactcccta
tggctcaccagtagtaatgttgaatatgagggcgaggaggaacatcaagagtatgttgag
aaagtgatcacaccaggtaggaggacagaacaaccatataactgtgatgaagaccaggag
gctgattgtcatgagccaaagcgaggctcacctttctgtctacaaaccctgagctccgag
ccaaatcacaacaagggcaacaatatctccactgtgcctgaacttgagctacagaagctg
gagcgagatttctacctgagcagtctgtcccagcctcagtctgctgagatgcaggagcag
ctcttgtcttgtctcagcagtgatccatattccaattgggaaccttgggacaaaaaggac
tctggccgctggtccctgagcccaggagatgactacagctccggtgtcttctcctgcaac
agtcagccagatgtgcaagtcgtcggtatggatttgctcagtcacacacagctaccacca
ccctgttgttttgaaggggtggatgtgtgcatcagagacttcaggaggagaagcatccgg
atcagagagacacgccgggtgaaaattggccacatcgccactggaatcagtgaccagata
tctaagagggttttcactctggagacccaacagggccagcagattgctcacgatgaagag
gtgcaggagtctggtctggagctctgctgtgttcctgctccagacttcagtcctggctgg
aggtggagaatcagagatggggtgctggaaacgagatag

DBGET integrated database retrieval system