KEGG   Monopterus albus (swamp eel): 109964351
Entry
109964351         CDS       T05607                                 

Gene name
cdk1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04540  Gap junction
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109964351 (cdk1)
   04114 Oocyte meiosis
    109964351 (cdk1)
   04115 p53 signaling pathway
    109964351 (cdk1)
   04218 Cellular senescence
    109964351 (cdk1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109964351 (cdk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109964351 (cdk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109964351 (cdk1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109964351 (cdk1)
   03036 Chromosome and associated proteins [BR:malb03036]
    109964351 (cdk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109964351 (cdk1)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109964351 (cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     109964351 (cdk1)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109964351 (cdk1)
DNA replication proteins [BR:malb03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    109964351 (cdk1)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109964351 (cdk1)
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109964351 (cdk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Seadorna_VP7
Other DBs
NCBI-GeneID: 109964351
NCBI-ProteinID: XP_020463254
LinkDB
Position
Unknown
AA seq 310 aa
MKQDKAIMEDYLKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLESEEEGVPSTAVREVS
LLQELKHPNVVRLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQIL
EGIYFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPE
VLLGSPRYSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDVWPEVEC
LPDYKNTFPKWKSGNLSSMVKNLDKNGLDLLAKMLTYNPPKRISAREAMTHPYFDDLDRS
TLPAASINKV
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaacaagacaaggcaataatggaggactacttgaaaattgagaaaattggagaaggt
acctatggggtggtgtataagggtaggcataaggccacagggcaggttgtggctatgaag
aagatccgcctggagagtgaggaggagggggttcccagcactgctgtcagagaggtctct
ctgcttcaggagctaaaacatcccaatgttgtacgactcctggatgtcctgatgcaagag
tctcgtctttacctcatctttgaattcctttccatggacctgaagaagtacctggattcc
atcccctctggccagtacatggaccctatgttggtgaagagctacctttaccagatcctg
gaaggtatttacttctgccactgtcgtcgggttcttcatcgggacctaaaaccccagaac
ctcctgattgacaacaagggagttatcaaactggcagactttggcttggctcgggccttt
ggtgttcctgtcagggtttatacccatgaggttgtaactctttggtaccgggctccagag
gtccttctgggctcacccagatattcaacacctgttgacgtttggagcactgggaccatc
tttgctgaacttgctaccaagaagcccctgttccatggagactcagagattgaccagctt
ttcaggatcttcaggactctgggaaccccaaacaatgatgtgtggcccgaagtagaatgc
cttcctgattacaaaaacaccttcccaaaatggaagtctggaaacctgtcgtccatggtg
aaaaacctggataagaatggcttggacctactggcgaaaatgttgacctacaatcctccc
aagagaatctcagcacgggaggccatgactcacccctactttgacgacttggacagatct
accctgccagctgccagcatcaacaaagtctaa

DBGET integrated database retrieval system