Monopterus albus (swamp eel): 109964791 Help Entry 109964791         CDS       T05607                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism malb  Monopterus albus (swamp eel) Pathway malb04010   MAPK signaling pathway malb04137   Mitophagy - animal malb04140   Autophagy - animal malb04218   Cellular senescence malb04371   Apelin signaling pathway malb04625   C-type lectin receptor signaling pathway malb04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:malb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109964791 (rras)    04371 Apelin signaling pathway     109964791 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109964791 (rras)    04137 Mitophagy - animal     109964791 (rras)   09143 Cell growth and death    04218 Cellular senescence     109964791 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109964791 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109964791 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:malb04147]     109964791 (rras)    04031 GTP-binding proteins [BR:malb04031]     109964791 (rras) Exosome [BR:malb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109964791 (rras)   Exosomal proteins of bladder cancer cells    109964791 (rras) GTP-binding proteins [BR:malb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109964791 (rras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  109964791 NCBI-ProteinID:  XP_020464005 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSGKEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQQKVIPREDAQAFARENKIHYMEASAKNRYNVDESFLELVRIIRRFQEMESPPPQ THHTRKQKSGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggaaaagaggaaagattcaaactggtggtagtgggaggaggaggggttgggaag agcgccctgaccatccagttcatccagtcctactttgtgtcagactacgaccccacaatt gaggactcctacaccaagatctgcactgtggatggaaaggagacccggctggacatcttg gatacagcaggtcaggaggagtttggggcgatgagggagcagtacatgcgctcaggagaa ggcttcttactggtgtttgcactcaacgaccggggcagctaccatgaggtccagaagttc cacacccagatcctgagagtgaaggaccgagatgacttccccatggtgctggttggaaac aaggctgacctagagcagcagaaagtgatccccagagaggatgctcaggcgtttgccaga gaaaacaagatccactatatggaggcttcggccaagaatcgctacaatgtggatgaatcc ttcttggagctggtgcgaattatcagaagatttcaagagatggagagtcctcctcctcaa actcatcacacgaggaaacagaagagtggtggctgtccctgcgtcctcctctaa

DBGET integrated database retrieval system