KEGG   Monopterus albus (swamp eel): 109964861Help
Entry
109964861         CDS       T05607                                 

Definition
(RefSeq) trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109964861
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:malb01002]
    109964861
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109964861
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109964861
Peptidases [BR:malb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109964861
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109964861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109964861
NCBI-ProteinID: XP_020464087
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MKAFIFLALFAVAYAAPFNDDDKIVGGYECRKNTVPYQVSLNVGYHFCGGSLISSTWVVS
AAHCYQSRIEVHLGEHNIAVSEGTEQSINSAKVIRHPGYSSYNLDNDIMLIKLSKPATLS
SNIKTVSLPSSCASAGTYCLISGWGNISSSSSNYPDRLMCLDAPILSDTSCRNSYPGEIT
ANMFCAGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGYGCAQRNRPGVYTKVCNYNAWIR
NTMSSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcatctttctggctctgttcgcagtggcatatgctgctccctttaatgac
gatgacaagattgttggaggctacgaatgcagaaagaatacagtgccctaccaggtctct
ctgaacgttggctaccacttctgcggaggctccctgatctccagcacttgggtggtgtct
gctgctcactgctaccagtctcgcattgaggtgcatcttggtgaacacaacatcgccgtc
agtgagggcacagagcagtccatcaactctgctaaggtcatccgtcaccccggctacagc
agctacaacctggacaatgacatcatgctgatcaagctgagcaagcccgccaccctgagc
agcaatataaagactgtgtccctgccctctagctgtgccagtgcaggcacctactgtctg
atctctggctggggcaacatcagcagctcttcaagcaattaccctgatcgtctgatgtgc
ctggatgcccccatcctaagtgacaccagctgcaggaactcctaccccggggagatcacc
gccaacatgttctgtgctggattccttgagggaggcaaagattcctgccagggtgactct
ggtggccccgtggtgtgcaacaatcagctgcagggcatagtgtcctggggttatggctgt
gcccagaggaacaggcctggagtctacaccaaggtctgcaactacaacgcctggattcgt
aacaccatgtcctccaactaa

DBGET integrated database retrieval system