KEGG   Monopterus albus (swamp eel): 109965272
Entry
109965272         CDS       T05607                                 

Gene name
gorab
Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109965272 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109965272 (gorab)
Membrane trafficking [BR:malb04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    109965272 (gorab)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 109965272
NCBI-ProteinID: XP_020464807
LinkDB
Position
Unknown
AA seq 352 aa
MSGWAGFSDEELRRMQQRDLAAARGRKPAPANRSRQQLQRERALQLAAQKNAGTDSPELP
PEQLLTKPPPKEEPQPAAPSGAPAVKQEVKEKPSLLKSTESCHSAAEEETPAVKELDKQE
VELREKTRLEQLQQEQQIIEERNKRKKALLTKTIAEKSKQTQAEAVKLKRIQKELQALDD
MVSSDIGILRGKIEQASWDYTAARKRYQKAESEYVMAKLDLHKKTEVKEQLTEHLCAIIQ
QNELRKAHKLEELMQQLQLQATVEEPERPTEEDEKERKRRRSSSYIDVQRDGKEGNGSVQ
STTDCKPTEEEAVKEEKGGDVQQEHSPCTEPPKTEQDCRPVENGAVSETAAS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgagcggctgggctggtttttctgatgaggaactacggaggatgcagcagagagactta
gcagcagcccgcggtcggaaaccggctccagccaaccggagccggcagcagttacagcgg
gaaagggctcttcagttagccgcccagaaaaatgcaggaacagattcaccggaacttcca
cccgagcaactgctcactaaaccaccgccgaaggaagagcctcaacccgccgctccatca
ggcgctccggctgtcaaacaggaggtgaaggagaagcccagcctgttgaagtcgactgaa
agttgtcattcggctgcagaggaggagaccccggctgtgaaagagctggacaaacaagag
gtggaactacgggaaaagacgcgtctggagcagctgcagcaagagcaacaaataatcgaa
gagagaaacaagcgcaagaaagctctgctgacaaaaactattgctgagaagtccaaacag
actcaggcagaggccgtgaagctcaagagaatccagaaagagctgcaggccctcgatgac
atggtgtccagtgatatcggcatcctgagaggaaagatagaacaggccagctgggactac
actgccgcgagaaagcgttaccagaaggcggagtcagagtacgtgatggccaagctggac
ctgcacaagaaaactgaggtgaaggagcagctgacggagcacctctgtgccatcatccag
cagaacgagctgcgtaaagcccacaaactggaggagctgatgcagcagctgcagcttcag
gccactgtggaggagccggagaggccgacggaggaggatgagaaggagaggaagaggagg
agaagcagcagctatatagatgtgcagagggatgggaaggagggaaacggctcagtacaa
tcaaccacagactgtaaacccacagaggaagaggctgtgaaggaggagaagggaggtgat
gtgcaacaggagcacagtccgtgcactgaaccaccaaagactgaacaagactgtagacca
gtagagaatggtgctgtgagtgagaccgcggcctcctga

DBGET integrated database retrieval system