KEGG   Monopterus albus (swamp eel): 109965494
Entry
109965494         CDS       T05607                                 

Gene name
tfdp1
Definition
(RefSeq) transcription factor Dp-1
  KO
K04683  transcription factor Dp-1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04110  Cell cycle
malb04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109965494 (tfdp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109965494 (tfdp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109965494 (tfdp1)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, DP
    109965494 (tfdp1)
SSDB
Motif
Pfam: DP E2F_TDP LMBR1
Other DBs
NCBI-GeneID: 109965494
NCBI-ProteinID: XP_020465189
LinkDB
Position
Unknown
AA seq 413 aa
MAKDAGLIETNGELKVFIDQNLSPSKGVLSLVTVQPTAAPVAKQLLPKTLGPSNVNVAAH
MQHLPHMVIGTPQRPTVSNTILVNSPHTPSSQFLTQSQPSDASPWSSGKRGKKGEKNGKG
LRHFSMKVCEKVQKKGVTTYNEVADELVAEFSSSDNHMSPNDSHVYDQKNIRRRVYDALN
VLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQKRLERIKQKQSQLQELILQQIAFK
NLVQRNRQTEQQANRPPPPNSIIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDSMFEIH
DDIEVLKRMGMACGLEVGKCSPEDLKVARSLVPKALEPYVIEMAKGPISNVYITGGSSAN
GARYPASSDGCTDGTMASSSNDSHYSGSRVETPVSYMGDDDDEDEYDENDDED
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggctaaagatgccggtctgattgaaacaaatggagagcttaaagttttcatcgatcag
aatctgagccctagcaaaggtgtcctgtcgttggttactgtccagcctacagctgcccct
gtggctaaacagctactgcccaaaacccttggtccatccaatgtgaatgttgctgcacac
atgcaacatttgccacacatggtgattggaacaccccagaggcctacagtatcaaatacc
attttggtgaacagtccacatacaccaagttcccagttcctcactcagagtcaaccatct
gatgcctctccttggtcatcgggaaagcgtgggaagaaaggggaaaagaatgggaagggc
ttgagacatttttccatgaaagtgtgtgagaaggtgcagaagaaaggagtaaccacatac
aatgaagttgcagatgaactggttgcagaattcagctcttcagacaaccatatgtcaccc
aatgactcgcatgtgtatgaccagaagaacattcgtcggcgtgtgtacgatgcacttaat
gtgctcatggcaatgaacattatctctaaagagaaaaaagaaatcaagtggattggcttg
cccaccaactcggcccaggagtgtcaaaacctagaggtggaaagacaaaagcgactggag
aggattaagcagaaacagtcacagcttcaggagctcatactgcagcaaatagcttttaaa
aacctggttcagcggaacagacagacagagcagcaggcaaacagacctccacctcccaac
tccatcatccaccttccctttattattgtcaacaccagcaagaaaactgtcattgactgc
agcatctctaatgacaagtttgagtatttgttcaatttcgacagcatgtttgagatccac
gatgacattgaagtgctgaaacgtatgggtatggcctgtggtttggaggtggggaagtgt
tctccagaggatctgaaggttgcacggagcctggtgcccaaagcactggagccctatgtt
atagagatggcaaagggtcccatcagtaacgtctacatcactggaggatcctctgctaat
ggagcccgttaccctgcaagcagtgatgggtgcactgatggcaccatggcctccagctcg
aatgactctcactacagtgggtctcgtgtggagactccagtgtcgtacatgggggacgat
gacgatgaagatgagtacgatgagaatgacgatgaagactaa

DBGET integrated database retrieval system