KEGG   Monopterus albus (swamp eel): 109966311Help
Entry
109966311         CDS       T05607                                 

Definition
(RefSeq) histone deacetylase 4-like
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109966311
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109966311
Enzymes [BR:malb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109966311
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109966311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 109966311
NCBI-ProteinID: XP_020466718
LinkDB All DBs
Position
Unknown
AA seq 1089 aa AA seqDB search
MNSHCQPVDVSTAALPTQVPPTTTAILPMDLSVVDHSHHHHHHQQQLPFGLIPQPHPTPP
ASIEPGCGPNIGHQEQQLQQELVALKHKQQLQRQLLIAEFQRQHEQLSRQHEVQLQEHIK
QQKELLALKHQQELLEHQRKMEQQRHEQHLEKQQREHKLQQLKNKERGQESAVASTEVKM
RLQEFVLNKKKALAQRNLNHCLPSDPRYWYGKTQHSSLDQSSPPQTALSAYNHQMLGTYD
SKDDFPLRKTASEPNLKFRSRLKQKVTERRSSPLLRRKDGPISTAKKRSLDVTDSACNSA
PGSCPSSPNNSSSNIPKENGVTNSSSPGEASLLHRLAARECSLSQLSLYTSPSLPNITLG
LPATGPANTVVSGHQDGESHLPALQQGIPLTPPFLPTAHLPSYLASSALDREGAGGGTAG
HNSLLQHMVLLEQSHNPMVGLGGLPISSPPVSKLARGHRPLGRTQSAPLPQQQCGQAQAL
QQLVVQQQHQQFLEKHKQLFQQQQQQQQHRGNKIMSKPSDQVSAAGSSTSGPARQHQSHP
EETEEELREHQGLSSSSSSSSTSAQETGALRGLVIKQEPPDAQEQEDSEQRERQAEQDFL
FRQQALLLEQQRIHQLRNYQASMEAAGLSVSFAGHRPLSRAQSSPASASFPMVAQEPPAK
PRFTTGLVYDSLMQKHQCMCGNSTSHPEHAGRIQSIWSRLQETGLRSHCECIRGRKASLE
ELQTVHSEAHVLLYGTNPLRQKLDCSVSPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAV
GSVVELVFKVASGELKNGFAIVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKIL
IVDWDVHHGNGTQQAFYTDPSVLYLSLHRYDDGNFFPGSGAPDEVGSGAGVGFTVNMAFT
GGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVDGHAPPLGGYKLTAKCFGY
LTRQLMALAGGRLVLALEGGHDLTAICDASEACVSALLGGELDPIPDEVLQQRPNANAVH
SIEKVIEAHSKYWHSLQRSASTLGCSLSEALRRDTEEAETVSAMASLSVASKHIGKRAEE
EPMEEDDPM
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcactgtcaaccagtggacgtgagcacagcagcactgcccacgcaggtgccc
cccaccaccacagccatccttcccatggacctgagcgtagtggaccattctcaccaccac
caccaccaccagcagcagcttccctttggcctgattccccaacctcacccaacaccacct
gcctctatcgaaccaggctgtggcccaaacattggccaccaggagcagcaactgcagcag
gaactggtggcgctcaaacacaagcagcagctccagaggcagctgctgatcgcagagttc
cagaggcagcatgaacagctgtcacgacaacatgaagtccagctgcaggaacatatcaag
cagcaaaaggagttactagcactcaaacaccaacaggaactactggagcatcagaggaag
atggagcagcaacgtcatgagcagcacctggagaagcagcagcgggaacacaaactccaa
cagcttaaaaacaaggagaggggacaagagagtgctgttgccagtacagaggtaaagatg
cgacttcaggagtttgtgctgaacaagaagaaagccttggctcagcgaaatctaaaccac
tgtctgcccagtgacccacgctactggtatggaaaaacccagcatagctctttggatcag
agctctcctccccaaacagcactgtctgcatacaaccaccaaatgctgggcacatacgac
tctaaagatgacttccctctgcgcaaaacagcctccgagcccaacttgaagtttcggtcc
aggctaaagcagaaggtgacagagcgccgcagcagccctctgctgcgcaggaaagatggt
cccatcagtactgccaagaagcgttccctagatgtgactgattctgcgtgcaacagtgca
ccgggctcatgtccgagctcccccaacaacagctctagtaacatccccaaagaaaatggg
gtaaccaactccagcagcccaggagaggcctccctgcttcacaggttggctgcaagggaa
tgttcacttagccagctctctctttacacctccccttctctgcccaacatcaccctggga
ctgccagccacaggccctgctaacactgtggtatcaggacaccaagatggtgagagtcat
ctgcctgcgttacagcagggcattcctctgacccctcctttcctgccaactgcccacctg
ccctcctacttggcatcgtcagcgcttgacagggaaggtgctggagggggcacagctggt
cacaactcgcttctccaacacatggtactgctggagcagagccataacccaatggttggt
ctgggtggcctcccaatatcatcaccccctgtctccaagcttgcacggggccaccgtccc
ctggggagaacacagtcggccccactgccccagcagcagtgtggacaggcccaggccctg
cagcagctggtggtccagcagcagcaccagcagttcctggagaaacacaaacaactgttc
caacagcagcagcagcagcagcagcacagaggaaacaagataatgtccaagcccagtgat
caggtctcagctgcaggctccagcacctcagggccagccaggcagcaccagagtcaccca
gaggagacagaagaggagctcagggaacaccaggggctgtcctcctcatcctcatcctcc
tctacctctgcgcaggagacaggggcgctacgggggctggtcatcaagcaggagccccca
gatgcccaggagcaggaagacagtgagcagagagagagacaagctgagcaggacttcctg
ttcagacagcaggctctgctgttagagcagcaacggatccaccagttgaggaactaccaa
gcctccatggaagcagctgggctatcggtcagctttgctggacaccgccccctctccagg
gctcagtcgtctccagcctccgcttccttccccatggtggctcaggagccacctgccaaa
cctcggtttactacaggtctggtatatgactcattgatgcagaagcaccagtgtatgtgt
ggtaacagcaccagtcatccagagcatgctggccgcatccagagtatctggtcacgacta
caggaaacaggcctcaggtcgcactgtgagtgtatccgtgggaggaaggcctcactagag
gagttacaaacagtccactctgaagcccacgtcttattgtacggaactaaccctctccgg
cagaaactagactgttcagtgagtcccatgtttgtgaggttaccatgtggaggcataggg
gtggacagtgacaccatttggaatgaggtgcattcatccagtgcagctcgtctggctgtt
ggctctgtggtggagctggtcttcaaagtagcatcaggagaactgaagaacggttttgct
atagttcgaccacctggacaccacgctgaggagagcacgcctatgggtttttgttatttc
aactcagtcgccatagcagccaagctcctgcagcagaggctcaatgtcagtaaaatcctc
atcgtagactgggatgttcaccacggtaatggtacccagcaggccttttacaccgacccc
agcgttctctacctgtcactgcatcgctacgatgatggaaacttcttcccaggcagtggg
gcacctgatgaggtgggcagtggagcaggtgtaggattcacagtcaacatggcctttact
ggaggactggaacctcccatgggcgatgcagaatacctggctgcattcaggacggtggtt
atgcctattgccaatgagtttgccccagacgtggttctggtatcttcaggctttgatgca
gtagatggacatgctccgcccctgggaggatacaaactgacagccaaatgctttggctac
ctgaccaggcagctgatggctctggcaggcggccggttggtgcttgccctggaggggggt
cacgacctcacagccatatgtgatgcctccgaagcctgcgtgtctgctttgcttggcggt
gagttggaccccattcctgacgaggtgctacagcagagaccaaatgccaatgctgtccac
tctatcgagaaagttattgaagctcacagtaaatactggcactccctgcagcgctctgcc
tccacccttggttgctccttgagtgaagccctccgtcgtgacacagaggaagcagagact
gtctctgctatggcctcactgtctgttgccagcaagcacattggaaagagggctgaagag
gaaccgatggaagaggatgatcctatgtaa

DBGET integrated database retrieval system