KEGG   Monopterus albus (swamp eel): 109967100Help
Entry
109967100         CDS       T05607                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00010  Glycolysis / Gluconeogenesis
malb00030  Pentose phosphate pathway
malb00051  Fructose and mannose metabolism
malb00052  Galactose metabolism
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb01230  Biosynthesis of amino acids
malb03018  RNA degradation
Module
malb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109967100
   00030 Pentose phosphate pathway
    109967100
   00051 Fructose and mannose metabolism
    109967100
   00052 Galactose metabolism
    109967100
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109967100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109967100
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:malb03019]
    109967100
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109967100
Protein phosphatases and associated proteins [BR:malb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109967100
Messenger RNA biogenesis [BR:malb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109967100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 109967100
NCBI-ProteinID: XP_020468112
LinkDB All DBs
Position
Unknown
AA seq 797 aa AA seqDB search
MAGATAPRRQDTRKFFENMSGAGKSIAVLTSGGDAQGMNGAVRAVVRMGIYVGAKVYFIH
EGYQGMVDGGDNIEEATWESVSSMLQVGGTVIGSARCKEFRTREGRLKAAHNLVQHGISN
LCVIGGDGSLTGANLFRAEWSGLLDELLQEGLIDEEAAHRYSVLHVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPE
MPPEDGWEDNMCQKLSENRADKKRLNIIIVAEGAIDCHNKSITPDYIKDVSMXCLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVLALLEASANTPACVVSLVGNQAVRLPLMECV
QMTQEVQKAMDEKKFEEAVRLRGRSFENNLNTYRLLSNRKPDSEIPNSSFNVAVLNVGAP
AAGMNAAVRSAVRVGITEGHKMFAVSDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKR
TLPAKHLDKIAEQMRIHNINALLVIGGFEALESLLQLSQARATYEEFCVPMCMLPATISN
NVPGTDLSIGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLATVGGLAAGAD
AVYIFEESFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENFTTDFIYQLYSEEGRGV
FDCRKNILGHMQQGGAPSPFDRNFGTKVSAKAVQWISRTLKDCYKGGRVFTNSEDTACLL
GMRRRALVFQPVAQIRDETDFVCRHPRALSFIPKERWWLKLRPLMKILAKYKTSYDISDS
GQLEHVTRVRPKESDAS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgcgacggcaccgagaagacaggacacccggaaattctttgagaatatgtcc
ggcgctggtaaatccatcgcagtgttgactagtggaggagatgcccaaggaatgaatgga
gcggtccgggccgtcgtccgaatggggatctacgtgggagcgaaggtctacttcatccat
gagggctaccaggggatggtggacggtggcgacaacatcgaagaggcgacgtgggaaagc
gtctccagcatgctgcaagtgggtggtacagtcatcggcagcgcccgctgtaaagagttt
cgtacccgcgagggccgcctcaaagctgcacacaacctcgtgcagcacggcatcagtaac
ctgtgtgtgattggcggtgacggcagccttaccggagccaacctgttcagagcggagtgg
agtggcctgttggatgagcttctgcaggaagggctgatcgatgaggaagccgcacacagg
tactccgtgctccatgtcgtcggcatggttggctccatcgacaatgacttctgcggcacc
gacatgaccattggcaccgactcagccttgcaccgcatcattgaggtggtggacgccatc
atgaccactgctcagagccaccagaggacgtttgtgctggaggtcatgggcaggcactgc
ggatacctggccctggtcagcgccctggcatgtggggcagactgggtttttatcccagaa
atgcctcctgaagacggctgggaggataatatgtgtcagaaactgtctgagaaccgtgct
gataagaaaaggctgaacattattatagtagccgagggcgccatagattgccacaacaag
tctataactcctgattatatcaaggatgtaagtatgnnntgcctgggttttgacaccagg
gtcaccatcttgggccacgtgcagagaggtgggaccccctcagcctttgacaggatcctg
gccagccgtatgggtgtggaggcagtgctggcattactggaggcctctgccaacaccccg
gcctgtgttgtgtccctggttggcaaccaggctgttcgcctgccacttatggagtgtgtt
caaatgacccaagaagtacagaaggccatggatgagaagaagtttgaagaggcagtcaga
ctgcgtgggaggagctttgaaaacaatctgaacacctacagactcctctccaaccggaaa
cctgactccgagatccctaatagctcctttaacgtggcggtgctgaatgtcggcgcccca
gcagcaggtatgaatgccgccgtgcgctctgctgtcagagtgggaataaccgaaggccac
aagatgtttgctgtcagcgatggcttcgagggattttacaaaggccagatcaaggagatc
aaatggggagatgtgggtggctggactggtcagggagggtcgctgctagggacaaaaaga
actcttccagcaaaacatctggataagattgctgaacagatgaggatccataacatcaat
gctctgctcgtcatcggaggattcgaggcccttgagtccctgctgcagctgtcccaggcc
cgggccacctacgaggagttttgcgtcccgatgtgcatgctgcctgccaccattagtaac
aatgtgcccggcaccgacctcagtatcggagctgacacatccctcaacgccatcgtggag
acatgtgaccgcatcaagcagtctgccagtggcaccaagcggcgggtcttcatcatcgag
accatgggcggctactgtggctacctggccactgtgggcggtctggctgcaggcgctgac
gccgtctacatctttgaggagtcatttgacatccgggacctgcaggccaacgtggagcat
ctgacggagaagatgaagacgagcatccagagaggcctggtgctcaggaatgagaacagc
aatgagaacttcaccactgatttcatctaccagctgtactctgaggagggacgaggagtg
tttgactgcaggaaaaacatcctcggtcacatgcagcagggaggagctccttctccgttc
gacagaaactttggcaccaaagtctctgctaaggccgtgcagtggatatcacggacactc
aaggactgttacaaaggagggcgagtgtttactaactcggaggacaccgcctgcctgctg
gggatgcgtcgcagagctctggtcttccagcctgtggcacagatccgggacgaaacggac
tttgtgtgtcgtcatccccgtgctttgtcctttatccctaaggagcggtggtggctgaag
ctgcgcccgctgatgaaaatcctggccaagtacaagacgagctacgacatttccgactcc
ggccagctggaacatgtgacacgggtccgacccaaggagagcgacgcctcttaa

DBGET integrated database retrieval system