KEGG   Monopterus albus (swamp eel): 109967174
Entry
109967174         CDS       T05607                                 

Gene name
casp9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04210  Apoptosis
malb04370  VEGF signaling pathway
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109967174 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109967174 (casp9)
   04115 p53 signaling pathway
    109967174 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109967174 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109967174 (casp9)
   01002 Peptidases and inhibitors [BR:malb01002]
    109967174 (casp9)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     109967174 (casp9)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109967174 (casp9)
Peptidases and inhibitors [BR:malb01002]
 Cysteine peptidases
  Family C14: caspase family
   109967174 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 109967174
NCBI-ProteinID: XP_020468222
LinkDB
Position
Unknown
AA seq 438 aa
MEERHKNVLRRNRVSLVRDLDPSNLYDGLIEKGVFTNNMIDEIKSSGTRGDQARKLVLDL
ETRGSRAFPLFLECLQETGQHSLAELLQTGAPTVQLQPATPTVRPVVQPLPVSSPVDVDK
QIKDVPVYPLQRPSAPTPSPEREHKRQKPQGRTRLDSIQIYKMDASPCGHCLIINNVDFE
PQSNLKSRKGSNIDCNKLERRFKALNFIVEVKSNLKQSKIKRELSALSKKDHLQYDCCVV
IMLSHGTEVSHNRFPGAVYGVDGQCVPVQLITDYLSGQKCPSLQGKPKLFFIQACGGGER
DMGFEVSPDEVEPSFGGADDQTDAIPMSSSSDSLSMSDELDARATLPTPSDILVSYSTFP
GYVSWRDPKSGSWYVATLDRILEENAATNDLVTMLMMVNNEVSQNSAKGLYKQMPGSFNF
LRKLLYFQTQASPTQSST
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggaggaaagacacaagaatgttcttcggcgcaacagggtcagtctcgtgagagacttg
gacccatccaacctttatgatggccttattgaaaaaggagtttttaccaacaacatgatc
gatgagataaagagctctggtaccagaggcgaccaggccaggaagttagtcctggacttg
gaaacccgtgggagtcgggcctttccattattcctggagtgccttcaggagacaggtcag
cacagtctagcagagctactacagactggagcaccaaccgttcagctgcagcctgcaaca
cccactgttcgccctgttgtccagcctctcccagtttcctctccagtggatgttgataag
caaataaaagatgtccctgtatatccattacagagacccagtgcacccactccatcacct
gagagggagcacaaaagacaaaagccacaaggcagaacccgactagacagtattcagatc
tataaaatggatgccagcccatgtggacactgccttatcataaacaatgtggattttgag
cctcagagcaatctgaagagtcgtaaagggtccaacatagactgcaacaagctggaaaga
agattcaaggcactcaactttattgtggaagtgaagtcaaacctaaaacaaagtaaaata
aaacgtgaactgtcagctttatctaagaaggaccatttgcaatatgactgctgtgtggtt
atcatgctgtcccatggcactgaggtaagtcacaaccgcttccccggtgccgtgtatggt
gtggacggacagtgtgtcccagttcagcttatcacagactacctcagcgggcagaaatgt
ccttcattacagggcaaacccaaacttttcttcatccaggcatgtggaggaggtgaaaga
gacatgggctttgaggtgtcccctgatgaggttgagccatccttcggcggagcagatgac
cagacagatgccataccgatgtcatccagcagcgactctctgagcatgtctgacgaactg
gatgccagagctactttgcccaccccaagtgacattctggtgtcctactcaacctttcct
ggttacgtctcttggagagaccccaagtcaggctcctggtatgttgcgacgctggaccgt
attcttgaggaaaatgctgctaccaatgatctggtcacaatgttgatgatggttaacaat
gaagtatcccaaaactcagcaaaagggctctacaagcaaatgcctggttcctttaacttc
ctccgtaaacttctctactttcaaacccaagcatcacccacgcaaagttcaacttga

DBGET integrated database retrieval system