KEGG   Monopterus albus (swamp eel): 109967312Help
Entry
109967312         CDS       T05607                                 

Gene name
setd2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109967312 (setd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109967312 (setd2)
Enzymes [BR:malb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109967312 (setd2)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109967312 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW AWS DUF1174
Motif
Other DBs
NCBI-GeneID: 109967312
NCBI-ProteinID: XP_020468452
LinkDB All DBs
Position
Unknown
AA seq 2643 aa AA seqDB search
MSFSMDTLLKSEIRDEGSGASVKVEGLSKAALIKSLSPRVMLYNHLLPKGSKMKVNLEDQ
GRQKVSFSFSQTKKPLKSRFFIHASPDKSVTEPQVASSQSTLDKGGQSTSKTEQKQTPTL
PSSTPETPSQTPFTSATKLKPDLAKIHFKKQILSVSVTEEKPTSVLQEEEHSSELQVQQV
NKSTSKSSAEFPTPQPQNVTSVCPSENAHIETSETRVTLSLKKPTASPGKDGETPSSTEQ
DNKVYKRKTRSQSNNAPLGSESDGDSVQMASSRKSADFKSKTNSDSRSKEVKKCSSVSHM
EEKEKSSSKRSENHERSSSYFKSDRDSRRTSSRSSRLDKDRRRSRSRSRSRSRGSRTSSS
HSRSERSRGDRGSRSERSYYHDSDRRSYRSSPRRERRRSHSRTDRTRDSSESEDDHRKTR
TRTSDSTRSSTHWSSHKESKSSSYSKSEKVSKSTGSPHSSDLDKRTQSSKSERTSKRLSD
SDLQHKSSPDLDSGYRISSTHHKSETNINSSFGMHTRSQTYEKCQKSSPSDSEADHKAKS
QALDKISGPEENSKNSLKKTSRQDLKQVTPFGSSVKTTGHDGQSDDIFHSSSKTQSHASV
TELCSQSEKEKSDSCQDVNEHSNQDLKEIVSHSENDLQEPSSKRPKEPTSSLEVENKLTS
AITSIETLKHVRVTLKNLIHVKDSLSSNNQPNVNLNEVVLNSCNSNDSIICSPAQNKKVV
DDSLGPRSLADTADIPVTHGPQENTKAEIEPNEPMTVNKQTDTSVPLKLDSSHLEFENQL
TCEQQSMDTVKKSSSTVKKSRWDIVGQDTLERDNSQRTLGAESKPTVKKVISVKKIEFSK
DNNQQDTGNKDNIQESETHSIPVKQTEISKQEVSLDGTFVAEKCEDQSEPPQVSTSIDLS
DLKQTVSQNTEDEPLHINDISKVDTPAKTLSWNDDEHEEKSKDSGHNTTVIKKSLIQDTS
GGQSEASDSDNSEYDSDCGEAIKRLHSVVVVPKNSSLTMDRHDTGASCIPVNNSERHNAD
IAADMNICEIPTQVTSEQRQVSPSIDFGAISGPYAGVNDSSNGSMLCQSQSDMIDSTSHS
EGSSSILALPYILGHVSTHRSATDPAHSLDNSRQCVQGHKQHAVSSRGEQMYPHYQHDDF
SSADNINNKNGISLGWDFSQTEQPSSTYQQPDSSHGPQLTNTKLIGASIKEQEHMQSNAP
WNHQSLNMPTSKNLYHHSHENYQDPAGEIHPDSLTNDHDDYSGEKSSNLSKTAVDFSGSN
TPGSYSFVQGHEISSNSRGSTMPDPRREDHFRPHRGRGPPKKRRPEIESDSDNEAEAGPA
GKRERQGDTDTCKETLVKAKVLCPSLTLLDFQDASKWKELAKSKKMPPYFDLIEENMYLT
ERKKNKSHRDIKRMQCECPVLPREERLRGVLACGEDCLNRLLMIECSSRCLNGTYCSNRR
FQMKQHADFEVILTEDKGWGLRAAKDLALNTFVLEYCGEVLDHKEFKTRVKEYARNKNIH
YYFMSLKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKAVTAGTELT
FDYQFQRYGKEAQKCFCGAPSCRGFLGGENRVSVRAAGGKMKKDRSRKSALTTVDEELEV
LLDNGEGLYDEKQVVSLCRLMVRVETMEQKLTCLKLIQDTQNPSCLKQFLDHHGLSLLWI
FMVELSEAKGNSANSIKLQLEIMKTLAVLPISTKNMLEESRVLTFIQRWAQTKTFPQPAE
MDGYSSENTSRAQTPLNTPDGSSTKLGPELDGDPSKPAVYRRLKIISENSLDSALSDASK
ASDGKEDEEDDDDDEEEDESSHAGLPVDKQLKTEPAAEAADPTKEMMEESVKEVSVEKQE
EAGMSSSSQHQPQTEEVKDEMELELKKEDTEMKEDTDEGLKEELEESKEASEEQVSGEEQ
TTQAVTEKAEVASDQPCVEVLEPENQLIQTDTADLPPELPSVQGETQVETQEAEKAHPGS
KAQPGESTTDALPGSEAPDATMSSEVTAVPLDPSVMGTPSQDEEEGVSDVESERSQEPQL
SALDISGMAARLLESWKDLKEVYRIPKKSQVEKEASDRSRDRDTALMPRTTSVSRERERE
REKDRERDRDYDRDRERDWDRDKDRDRDRDRVSEKTPRSTERRRRRSMSPPSSCYERSSR
RAEERFDPSNSNKTPRGAAGKERNKLSTEERRKLFEQEVAQREAQKQQQLQQQQLQTMVY
DPALAYASSPGFITYPPGYPIQTFVDPSNPNAGKVLLPTPSVEPTLSYEQTPPQRLISEL
GLTSPSSTSQATPVSNLSQHITTTNLNTGNPQQYAQPTVATQDAGVAVLSVPAQAAPQVQ
GQQSYTTLWDPTTQQAVTVQTQPAQPYATAPAQAQAQTAIYYQGQPCPTIYSIPTAYPQS
NTPVIQTYTEPTASYLHGPPVYSGHQQGVVVQQGGTVTTIVTSQTVQQEMLVSNNVMDLP
PPSPPKPKTIVLPPNWKVARDPEGKIYYYHVVTRQTQWDPPTWEGSSDNSSVDHESEMDL
GTPTYDENPSKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNPYRKPDCKLGRISN
TEDFKHLARKLTHGVMNKELKACKNPEDLECNENVKHKTKEYIKKYMQRFGSVYRPKEDT
EVY
NT seq 7932 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctcaatggacactctactcaagtcagagatcagagatgaggggagtggtgct
tcggtgaaggtggagggcctatccaaggcagcactaatcaaaagtctgtctcccagagtg
atgctatacaaccatctcttgcctaaagggagcaagatgaaggtcaacttagaggatcag
ggtcgtcagaaagtgtccttcagcttctcacagaccaagaagcccctgaaaagccggttc
ttcatccatgcaagccctgataagtctgtcactgaacctcaggttgcctcatcacagtca
accttagacaaaggagggcagagtacaagcaaaactgagcaaaagcagacacccacgtta
ccatcatcaacaccagagacaccgtctcaaaccccattcacctcagctactaaactgaaa
ccggacttagcaaagatacatttcaaaaagcaaattctcagtgtctctgtgactgaagag
aaaccaacatctgttttgcaagaggaggagcattcctctgaattgcaggtccagcaagtc
aacaagtcaacaagtaagagttcagcagagttcccaacaccccagcctcagaatgtcacc
agtgtctgcccatctgagaatgctcacattgaaacctctgaaacaagggtaactctgagc
ctcaagaagccaactgcttctccaggaaaagatggagagactcccagcagtactgagcag
gataataaagtatacaaaaggaaaaccaggtcccaatctaataatgctcctctgggctca
gaatccgatggagattcagtccagatggcttctagccgcaaatcagctgacttcaaaagc
aaaacaaattctgatagcagaagcaaagaggtaaaaaagtgttcctctgtttcacatatg
gaagaaaaagaaaaaagttcctctaagcggtcagagaatcatgaaaggtcttctagttac
ttcaaatcagaccgtgattctagacggacatcttcacgttcatctcgattagacaaagat
cgcagaaggtccaggtctagatcacggtctagatcaagagggtctcgaacaagttcttct
cactctagatcagagagatcaagaggtgacagaggatcacgctctgaaaggtcatactat
catgattctgaccgtcgatcatacaggagttctccacgcagagagaggagacgttctcat
tctcgcactgacagaactcgggacagttctgaatctgaggatgaccacaggaagactagg
acaaggacaagtgactccaccagatcatccactcattggagctcacataaagagtcaaaa
tcgtcttcctactcaaaatctgagaaagtttctaaatctacagggtctcctcactcttca
gacttggataaaagaacacagtcatcaaagtctgaaaggacttcaaagcgattgtctgac
tctgatttacagcacaagtcctctcctgatttggactctggttaccgtatatctagcacc
catcacaagtcggagactaacattaattcttcttttggtatgcatacccgctctcaaaca
tatgaaaaatgccaaaaaagcagccccagtgactctgaggcagatcataaggcaaaatca
caggctttggacaaaatctctggcccagaggaaaacagcaaaaactccctaaagaaaacc
agtagacaagacttgaaacaagtgaccccttttggatcttctgtaaaaaccactggacat
gatggacaatcagatgacatatttcacagctccagcaaaactcaatcccatgcatccgtt
acagaactgtgttctcagagtgaaaaagaaaaatctgattcttgtcaagatgttaatgaa
cacagtaatcaggatcttaaggaaattgtctcacatagtgaaaatgatttgcaagaacca
tcatccaaaaggcctaaagaacctacatcaagtcttgaagttgagaataaattgacctca
gctataacctcaattgaaaccctaaagcacgtaagagtcaccctaaaaaacttgatccat
gtgaaggacagcctttcttctaataatcaaccaaatgtgaacttaaatgaggttgtctta
aattcatgcaatagtaatgatagtataatatgcagcccggcccagaacaagaaagtcgtt
gacgactcactagggccaaggtccttagcagatacagcagatatacctgtcacacatggc
ccacaggagaacactaaagcagagattgagccgaatgaacctatgacagtcaacaagcaa
actgacacaagtgtgccactcaaattggattcttcccatcttgaatttgaaaatcagcta
acatgtgaacagcaaagcatggatactgttaaaaaaagcagcagtactgtcaaaaaatct
cgatgggatattgttgggcaggacaccttagagagagataattcacagaggacacttggt
gcagagagtaagcctactgttaaaaaagttatctctgtcaaaaagatagagttttctaaa
gacaacaaccaacaagacactggcaataaagataatattcaagaatctgaaacacattcc
ataccagtgaagcagactgagatctctaagcaggaagtcagcctagatggtacctttgtg
gctgaaaaatgtgaagaccaaagtgagccaccacaagtaagcaccagcattgacctcagt
gatttaaaacagactgtttctcaaaacacagaagatgagcctctacatataaatgatatc
tcaaaggttgacacacctgcaaaaacgctaagttggaatgatgatgaacatgaagaaaaa
tcaaaggacagtggtcacaataccacagtgattaagaaatcacttattcaggatacatca
ggggggcagagtgaggccagtgatagtgacaactcagagtatgactctgattgtggtgag
gctataaaacgattgcactctgtggtagtagtgccaaagaattcatccctaacaatggat
agacatgacacaggagcttcctgcattcctgtgaataattcagaacggcacaatgctgat
atagcagcagacatgaatatctgtgaaatcccaactcaagtcacttctgaacaaagacag
gtgagtccttccattgattttggtgcgatcagtggtccttatgctggggtaaatgactca
tccaatggcagtatgttgtgtcaatcccagagcgatatgattgatagcaccagtcactct
gagggttccagctccatccttgccctaccctacatccttggtcatgtcagtactcataga
agtgctacagatcctgctcacagcctagataattccagacagtgtgtacaagggcacaaa
cagcatgcagtaagcagcagaggtgaacagatgtatccccattatcaacatgatgacttc
tccagtgctgataatatcaataacaagaatggaatcagcttgggctgggatttttcacaa
acagaacagcccagtagtacatatcagcagcctgatagcagtcatgggccacagttaaca
aacactaaactgataggagcctctattaaagaacaagagcacatgcagagtaatgccccc
tggaaccaccaatcccttaacatgcctactagcaaaaacctctaccaccattcgcatgaa
aattatcaggatcctgcaggtgaaatccatcccgactctctcactaatgaccatgatgac
tacagtggtgaaaaatcatcaaatcttagtaaaacagctgttgatttcagtggatctaac
actccagggtcatatagctttgtacagggtcatgaaataagcagtaacagcaggggctct
acaatgcctgacccccgcagagaagaccattttagaccccatagaggcaggggtccaccc
aagaaaaggcgtccagagattgagtcagattcagacaatgaggcagaagctgggcctgca
ggcaaacgggagcgtcaaggagatactgatacctgtaaggaaacgcttgtcaaagctaag
gtgctgtgtccatcacttactctgctggattttcaagatgccagtaaatggaaagagttg
gccaaatctaagaagatgcccccttatttcgacttgattgaggaaaacatgtacttgact
gagagaaaaaagaacaaatctcatcgagatatcaagcgaatgcaatgcgagtgcccagtg
ttgcccagagaggagcgtttaagaggagtactagcatgtggggaagactgtttaaaccgg
ctgctgatgatcgagtgctcatcacgctgcctaaatggaacctactgctctaatcgtcgc
tttcagatgaaacaacatgcagactttgaggttatcctcacagaagacaagggctgggga
ctacgggcagctaaagacttggctctaaacacctttgtactggaatactgcggggaagtt
ttggatcacaaggagttcaaaacaagggttaaagaatatgctcgcaataaaaacatccac
tactacttcatgtctctaaaaaataatgagattattgacgcaacactgaagggtaactgc
tctcggtttatgaaccatagctgcgagcctaactgtgagacccagaagtggactgtcaat
ggccagcttagagttgggttcttcaccaccaaggctgttactgcaggaactgaactgaca
tttgattaccagttccagagatatggtaaagaagcacagaaatgcttctgtggtgcaccc
agctgcagaggcttccttggtggggagaacagagtcagtgttcgggcagctggagggaag
atgaagaaagaccgtagtcgaaagagtgctctcaccacggttgatgaggagctggaggtg
ttactggataatggagaaggcctgtatgatgagaaacaggttgtctctctctgcagacta
atggtccgagtagaaaccatggagcaaaaactcacctgtctcaagctcatacaagatact
cagaatccatcgtgcctgaagcaattccttgaccatcatggattgtctttgctgtggatt
ttcatggtggagctttctgaagctaaaggcaacagtgccaatagcatcaaactgcagtta
gagatcatgaagacgctggctgtgcttcctatctctactaagaacatgttggaggagagc
agagtcctgacctttattcagcgatgggcacaaacaaaaactttccctcagcctgctgag
atggatggctactccagtgagaatacctcccgtgcgcaaacacctctcaacactcctgat
ggttcctccaccaaactgggaccggaactggatggtgacccctccaaacctgctgtttac
cgccgccttaaaatcatcagtgaaaacagtctggacagtgctctctcagatgctagcaaa
gcatctgatggtaaggaggacgaggaggatgatgatgatgatgaggaagaagatgaatcc
tcacatgcaggacttcctgttgacaagcagctgaagacagaaccagctgctgaagctgca
gacccaacaaaagaaatgatggaagagtcagtgaaagaggtcagtgttgagaaacaggaa
gaggcagggatgagttcaagcagtcagcatcaacctcaaactgaggaagtgaaagatgaa
atggagttggaactgaagaaggaggacactgagatgaaagaggacacagatgagggtctg
aaggaagaacttgaggagtcaaaggaagctagtgaagaacaggtgagtggggaggagcag
actactcaggcagtgacagaaaaggctgaagtggcaagtgatcagccctgcgttgaagtt
cttgagccagagaatcagctcatccaaacagatactgctgatcttccacctgagctgcct
tcagtccagggcgaaacccaggtagagactcaagaggcagagaaagctcatcctggcagc
aaggctcaacctggtgaatctaccactgatgctctgcccggctctgaggccccggatgct
actatgtcctctgaggtgacggcagtccctttggacccatcggtgatgggaactccttct
caggatgaagaggaaggcgtctcagatgtggaaagtgagaggagtcaggagccgcaactc
agtgctttggacattagtggcatggctgccaggcttctggaaagctggaaggatctgaag
gaggtataccgaataccaaagaagagtcaggtggaaaaggaagccagtgatcgcagtcga
gatcgagacactgctttgatgccacgaaccacgtccgttagccgagaacgagaaagggag
cgagaaaaggacagggaacgagacagagattatgacagagacagggagcgagactgggac
agagacaaagatcgcgacagggaccgtgatcgagtctctgaaaaaactccacgcagcaca
gagagacggagaagacgctctatgtctccaccatcctcatgctatgagaggagcagccga
cgtgctgaggaaaggtttgatccttctaacagcaacaagacaccaaggggagctgctggc
aaggagcgcaacaagctatccacagaggaacgcagaaagcttttcgagcaggaggttgct
cagcgggaagcccagaaacagcaacagcttcagcagcagcagcttcagactatggtttat
gaccctgctctggcctatgcctccagtcctggcttcattacctaccctcctggttatccc
atccagacttttgtggatccctccaaccccaatgcaggcaaggtactgctccctacccca
tcagttgagcctaccctgagctatgagcaaactcctccccagcgtcttatctcagaattg
ggactcacatctccatcttccacttcccaagccactccggtctctaatctctctcagcat
atcaccaccaccaacctcaacactggcaacccccagcagtatgcccagccaactgtagca
acccaggacgcaggtgtagctgtcctctctgtcccagcccaggctgcccctcaggtacag
ggccagcagagctacaccactctctgggatcccaccactcagcaggcagtgactgtgcag
acccagccagcacagccatatgccacagctccagcacaggcccaggcgcaaacagccatc
tattaccagggtcagccatgtccaaccatctatagtatccccactgcctatcctcagagc
aacactccagtcatacagacgtacactgagcccacagccagctacctgcatggcccgcca
gtgtattctgggcatcagcagggagtggtggtgcagcagggaggcacagtcaccaccatt
gtcacatcccaaacagtccaacaggaaatgcttgtatctaacaatgtgatggacctgcct
cctccttctcccccaaaacccaaaactatcgtcttacctccaaactggaaagtggctcgg
gatcctgaaggcaagatctactactaccatgttgtcacaaggcaaacacagtgggacccc
cctacctgggaaggaagtagcgacaacagtagcgtggaccatgaatctgagatggacctg
ggaacaccgacctatgatgagaatccttccaagttctccacaaagacagctgaagcagac
acttccagtgaactcgctaaaaaaagtaaagagacatttcgcaaagagatgtcccagttc
atcgtgcaatgtttaaatccttatcggaagccagactgcaaacttggacgcatcagcaat
acagaagatttcaaacacctagctagaaagctgacacatggagttatgaataaggaactg
aaagcttgcaagaatcctgaggaccttgagtgtaatgagaatgtgaaacacaagaccaag
gagtacatcaagaagtacatgcagaggtttggttctgtgtacaggcccaaggaggacaca
gaggtgtactaa

DBGET integrated database retrieval system