KEGG   Monopterus albus (swamp eel): 109967407Help
Entry
109967407         CDS       T05607                                 

Definition
(RefSeq) transmembrane protease serine 9-like
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:malb01002]
    109967407
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109967407
Peptidases [BR:malb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109967407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a SEA Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109967407
NCBI-ProteinID: XP_020468598
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MEAKKDGEQGGLRSPSPSCYRCSLLALLFFFLFVGVLVGLLVAYLVPEEHYFMETVELKG
LKYDPVLKDRRSGFFIVLSSVLTFKIKDVFEASSMSSHYDGCHIVGYGNINGDVMATFRL
VFRMSKAQQFSDSFVQDLLRTGLRAALHEEPIEVPQFGEINTIVLLGASGKSFYTIGDER
MARCPNNTFTCDNGECVTKINPECDFIADCADGSDEARCACGTRPAMGSRIVGGENAQQG
ELPWQVSLRLHGHHTCGASILNKQWLVSAAHCFQGQNNPGEWMALVGARLISGAESVSKL
IKIKSVIVNPDYNPTTNDYDVSLLELETPLTFSSYIQPVCLPSSSHVFAPGQSCVVSGWG
ALNEFSIVLPSALQKAVVKVINTKECNNTSVYRGAITQNMMCAGFLQGRVDSCQGDSGGP
LVCEGAPGRFFLAGVVSWGMGCAQLNKPGVYTRITALSNWIVSHTDPSLVHDYLQYAPTV
PATVTERNFSDSAVPQTTAMSAPSLSVLKCNENFQCSATSCISKVNPECDSVPDCPNQAD
ESHCDCGVRPILGSHRIVGGVTARRGEWPWIGSLQYRSLHRCGATLIDRKWLLTAAHCFK
GDPSPINWAVSLGSVLRTGVGALIIPIHRVIIHPAFNGTNMDQDVALLELALPAPMSNTI
QRVCLPSPVHHFLKNAECYIAGWGSMKEGGSLTNLLQNAAVKIIDQADCQRPYRDALTPN
MMCAGYMEGGRDTCLGDSGGPLTCRQYSGQWFIAGVTSWGHGCGRIGFPGVYTRVTSVRT
WISTYLSF
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaagaaggatggagaacaaggaggtctgcggtctccttcaccttcctgctac
aggtgcagcctcctagctttgctcttcttcttcctctttgtaggagtgttggtgggtctt
ctggttgcatacctggtgccggaggagcattatttcatggagacagtggaactgaaaggt
ctcaagtatgatcctgttttgaaggataggcgctctggtttcttcatagtactgtcttcg
gttttaacgtttaagattaaagatgtatttgaagcctcatcaatgtcatctcactatgat
ggctgtcatattgttggctatggtaacattaatggtgacgtgatggcaacattcagactg
gtcttccgtatgtctaaggcccaacagttttcagacagctttgttcaggacttgctgaga
acagggctcagggcagcactgcacgaggaaccaatagaggtgccacagtttggagagatc
aataccatcgtcttactgggagcgagtgggaagtcattttatactattggagatgagaga
atggccaggtgtcctaataacactttcacttgtgacaatggggaatgcgtcaccaaaata
aatccagagtgtgacttcattgctgactgtgcagacggatctgatgaagctcgctgtgcc
tgcggtacacgtcctgccatggggagtcgtattgtgggtggtgagaatgctcaacaaggc
gagctgccatggcaggtcagtctgaggcttcatggacaccacacctgtggagcctccatt
ctcaacaaacagtggttggtcagtgcagcacactgctttcaggggcagaataaccctgga
gagtggatggccctggtaggggccagactgattagcggtgcggagtcggtgtctaagctg
attaaaatcaagtcagtgattgtgaatccagactacaaccccacaaccaatgactatgat
gtatctctactcgagctggagacccctctcactttcagctcttacatccagcccgtctgc
ttgccctcttcatctcacgtcttcgctccgggccagagctgtgtggtatcggggtggggt
gcattaaacgagtttagcattgtcctgccatctgcactgcagaaggcagtggtgaaggtc
atcaacaccaaggagtgcaataacacgtctgtgtacaggggtgctattactcagaatatg
atgtgtgctggcttcctgcagggcagggtggactcctgtcagggtgactctggagggccc
ctggtgtgtgagggagcaccgggaaggttctttctggctggtgtagtgagctggggtatg
ggctgtgcccagctcaacaagcctggggtttatacccggatcaccgctctgtccaactgg
attgtaagccacacagatcccagcttggtccatgattacctccagtatgctcccacagtg
ccagctactgtgacagaaaggaactttagtgattcagcagtaccccagaccacagccatg
tctgcaccatcactatctgtcttgaaatgcaatgaaaacttccagtgtagcgccacctcc
tgcatcagcaaggtcaacccagagtgtgacagtgtccctgactgccccaaccaggcagat
gaaagccactgtgactgtggcgttcgtcctatattgggcagccacagaatagtgggtgga
gtaacagctcgcaggggagagtggccttggattggtagtctccagtaccggagtcttcat
cgctgtggtgccacactcattgataggaaatggttactcacagcagcacactgcttcaaa
ggtgatcctagccccattaactgggctgtgagcctgggatctgtgctgcgcactggggtg
ggagccctgatcatccccatccacagggttatcatccacccggctttcaatggtactaac
atggaccaggacgtcgctctgctagagctggcactcccagcccccatgtctaacactatc
cagcgtgtctgtctcccctcaccggtgcaccactttctgaagaatgcagagtgctacatc
gcaggctgggggtccatgaaggaaggaggttcactgaccaacctgctacagaacgctgca
gtgaaaatcattgaccaggcagactgccagcggccgtacagagatgccctgactcctaac
atgatgtgtgctggttacatggagggaggccgggacacctgtttgggagattctggaggg
ccactgacttgtcgtcagtactctggccagtggtttattgctggagtgaccagctgggga
catggatgtgggcgaattggttttccaggggtgtacactcgtgtgacatctgtcaggaca
tggatatctacatacttgtctttctga

DBGET integrated database retrieval system