KEGG   Monopterus albus (swamp eel): 109967598
Entry
109967598         CDS       T05607                                 

Gene name
mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04120  Ubiquitin mediated proteolysis
malb04144  Endocytosis
malb04218  Cellular senescence
malb04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109967598 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109967598 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109967598 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    109967598 (mdm2)
   04115 p53 signaling pathway
    109967598 (mdm2)
   04218 Cellular senescence
    109967598 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109967598 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109967598 (mdm2)
   04121 Ubiquitin system [BR:malb04121]
    109967598 (mdm2)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109967598 (mdm2)
Membrane trafficking [BR:malb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109967598 (mdm2)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    109967598 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP
Other DBs
NCBI-GeneID: 109967598
NCBI-ProteinID: XP_020468960
LinkDB
Position
Unknown
AA seq 498 aa
MSADRQLSVDTADDNKLVRPKVEFRSLLQHAGATKDVFTMKEVMFYLGQYIIQKQLYDQK
QQHIVHCAQDALGRVLGIDSFSVKEPRLLFAMITKNLVAVKSQELPPSSVEPHSNSETDR
GTEEAGSESRSSSPKRRRRRSSRSNEPGSSHSVEDEEDEEESEEEEEEGRKRRRSDSYSL
TFDGSLSWCVIGGLGSGQDRRSSQSSESRSTSERSEVTVAASDSDSDNFSVEFEVESIDS
DDYNEDDASLSADDQVYEVTICEADDDDSFDEDTEISEADYWRCAKCEELNPPLPRHCLC
CWTLRQDWLPEASVNTSNSPSSSPKAFPTKPSNQSAAKESPGTDVEENEGVDVPDGKRAK
TPPLTKQGLSDSTSSAPNSEDLHSCSSSQEKLCTFDSQPSSSIDSQELLPSSPIASPSSP
LPAVPELERSVSAEWRLPESCLEPCVICQSRPKNGCIVHGRTGHLMSCYVCARKLKKRNK
LCPVCRLPIQSVILTYLS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtcagctgacaggcagctcagcgttgacactgctgatgacaacaaactggtcagaccg
aaggtagagttccgttctttgctgcaacatgcaggagctactaaagatgtcttcaccatg
aaggaggtgatgttctatctgggtcagtacatcatccagaagcagctgtatgaccagaag
cagcagcatatcgtccactgtgcccaggatgcactggggcgggtgctgggaatcgacagc
ttctctgttaaagagccacggcttctgtttgcaatgatcaccaagaacctggtggctgtg
aagagccaagagttgccgccaagctcggttgaaccccacagcaacagtgagacagacaga
gggacagaggaggcaggttcagaaagtcgctcttcatcaccgaagaggaggagacggagg
agcagcaggagcaatgaaccagggtcctcacatagcgtagaggatgaggaagatgaggaa
gagtcagaggaggaagaggaagaaggaaggaagaggaggaggtctgacagctactccctg
acctttgatggcagcttgtcctggtgtgtgattggtggtctggggagtgggcaggacaga
cgtagcagccaatcatctgagtcacgcagcacgtctgagaggtcagaggtcacagtcgca
gcctcagactcagacagtgacaacttcagtgttgaatttgaggtcgagtctatcgactct
gacgactacaatgaagatgatgcctctctgtctgcagatgaccaggtttacgaggtcacc
atttgtgaggctgatgatgacgactcctttgatgaagacacagagatcagtgaagctgac
tactggcggtgtgcaaagtgcgaggagctgaacccccctctcccaagacattgcctctgc
tgctggactttgcgccaggattggctgcctgaggcatccgtcaacacaagtaactccccc
tcctccagtcctaaagccttccccactaaaccatcgaaccaatcagcagccaaagaaagt
ccaggtacggatgtcgaggagaatgaaggagtcgatgttccagatgggaaaagagcaaaa
actcctcctctaacgaagcagggtctgtctgactccacctcctctgctcccaactctgag
gatctccactcatgctcctcctcccaggagaagctctgtacttttgactcccagccctcc
tcttccatcgactctcaggagcttctcccatcttcccccattgccagtccttcatctcct
ctccctgcagtcccagagctggaacgcagcgtgtcggcagagtggcggctgccggaatcg
tgcctggaaccgtgcgtcatctgtcagtcccggccgaagaatggctgcattgtccatgga
cgaaccggacacctcatgtcctgctacgtgtgcgctaggaagctgaagaagagaaataag
ctgtgtccagtgtgcaggctgcccatccagtctgtcatcctcacctacctcagctga

DBGET integrated database retrieval system