KEGG   Monopterus albus (swamp eel): 109967641
Entry
109967641         CDS       T05607                                 

Gene name
rfwd2
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
malb04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109967641 (rfwd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109967641 (rfwd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:malb04121]
    109967641 (rfwd2)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109967641 (rfwd2)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109967641 (rfwd2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109967641 (rfwd2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf-RING_10 Prok-RING_4 zf_C2H2_10 zf-RING_4
Other DBs
NCBI-GeneID: 109967641
NCBI-ProteinID: XP_020469025
LinkDB
Position
Unknown
AA seq 707 aa
MMSNNRPQQSAAGESSVPSTSSTGTGSTNGGGGSNAITSNGNNSGNVVPTRTLAAAGESS
LSVPTLAAVPSSRGGFASLSRPSASSSSKKKSLHQAPLYNGLLNSYEDKSNDFVCPICFE
MIEEAHMTKCGHSFCFKCIRQSLEDNNRCPKCNYTVDNVDQLYPNFLVNELILKQKQRSE
EKRLKLDHPNGSRWQVFQDVLSPDQENLDLANVNLMLELLVQKKKQLEAESQAAQRQILM
EFLKEARRNKREQLEQLQKEINFLEEDIKRVEEMSGLCSPVMEAECTVPNVEAPSPASSC
IIEPPDYSQPPGFGGAAQGKRQTWYNSTLASRRKRLMAHFEDLEQCYFSNKMSRITDEGR
NLNQLDDFMECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKK
IKVFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQ
RSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFS
PTSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKL
WNVNKTHCLRSFKGHINEKNFVGLASNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVK
SVLDKDKKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgatgtcaaacaaccggccgcagcaaagtgctgctggggaaagttcagtgcctagcaca
agtagcactggcacggggagcacaaacggtggcggtgggagcaacgctatcacaagtaat
ggtaataattctggaaatgttgtgcccactcggaccttggcagcagccggcgagagcagc
ttgtcggtgccaactttagcggccgtgccgtcgtcccggggcggttttgcttctctaagc
agaccctctgcgtcctcatccagcaaaaagaaatccctccatcaagcacccttatacaac
ggtctcttgaattcatatgaagataaaagcaacgattttgtctgtcccatttgcttcgaa
atgatagaagaggcgcacatgacaaagtgcgggcacagtttctgtttcaagtgtatccgc
cagagcctcgaggacaacaacagatgtcccaagtgcaactatactgttgataacgtggat
caactgtacccaaactttcttgtaaatgaactgatccttaaacagaagcaaaggtcggag
gagaagagactaaaattagatcatcctaatgggtccaggtggcaggttttccaggatgtg
ctgagtcctgaccaagagaacttggacctggcaaatgtcaatctgatgctggagctcctc
gttcaaaagaagaagcagctggaggcagaatctcaagcagctcagagacagatcctcatg
gagttccttaaagaagccaggagaaacaagagagaacaactggagcaactgcagaaagag
atcaactttctcgaagaggacattaagcgagttgaggaaatgagtgggttatgttcccca
gttatggaggcagagtgtacagtgcctaatgttgaggctccctcaccagcatccagctgt
atcattgagccaccagactatagccagcctccaggatttggaggagcagcccagggaaaa
aggcagacctggtacaacagcaccttggcctcgagaagaaagaggctgatggctcatttt
gaggatctggagcagtgctacttctccaacaaaatgtcccgcatcacagatgagggcagg
aacctgaaccagttggatgattttatggagtgcttgtccaaattcacccgctacaactct
gtgcggccactagccaccctctcctatgccagtgacctctataacggctccagtatcgtc
tccagtattgagtttgaccgtgactgtgactactttgccattgctggtgtgaccaagaag
atcaaggtgtttgagtacggcactgtgatccaggatgctgtggacatccactaccctgtc
aacgaaatgacctgtaattccaaaatcagctgtatcagctggagcagctatcataagaac
cttctagccagcagtgactatgagggtaccgtcatcctgtgggatggattcaccggccag
aggtccaaagtctaccaggagcatgaaaaaaggtgttggagtgttgacttcaatctgatg
gaccccaagctcttagcctctgggtctgatgatgctaaagtgaagttatggtcaaccaat
cttgacaattccgtggccagcattgaggcaaaggccaatgtgtgctgtgttaaattcagt
ccgacctccagatatcatctggcctttggctgtgcagaccactgtgtccactactatgat
ctacgcaacactaagcagcccatcatggtgttcaaaggtcacaggaaggccgtgtcctac
gccaagtttgtcaatggggaggaaattgtttctgcttcgacagacagtcaactgaagctg
tggaatgtcaacaaaacccactgtctgcgctcctttaagggtcacataaatgagaagaac
tttgtaggactggcttccaatggagactatgttgcctgtggtagtgagaacaattctctg
tacctgtactacaaaggactttccaaaacactgttaacattcaagtttgacacagtgaag
agtgtcctggacaaggacaagaaggaggacgacaccaacgagtttgtcagtgctgtctgc
tggagggccctgcctgatggagagtcaaatgtactgattgctgcaaatagtcaaggaaca
atcaaggtacttgagcttgtctga

DBGET integrated database retrieval system