KEGG   Monopterus albus (swamp eel): 109967822
Entry
109967822         CDS       T05607                                 

Gene name
igf1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04150  mTOR signaling pathway
malb04510  Focal adhesion
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109967822 (igf1)
   04068 FoxO signaling pathway
    109967822 (igf1)
   04150 mTOR signaling pathway
    109967822 (igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109967822 (igf1)
   04115 p53 signaling pathway
    109967822 (igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109967822 (igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109967822 (igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109967822 (igf1)
Cytokines and growth factors [BR:malb04052]
 Growth factors
  Growth factors (RTK binding)
   109967822 (igf1)
SSDB
Motif
Pfam: Insulin CENP-U
Other DBs
NCBI-GeneID: 109967822
NCBI-ProteinID: XP_020469315
LinkDB
Position
Unknown
AA seq 185 aa
MTSALSSQWHLCDVFKSAMCCISCSHTLSLLLCILTLTPTTTGAFPETLCGAELVDTLQF
VCGERGFYFSKPGYGSSTRRSRGIVDECCFQSCELWRLEMYCAPAKTSKPARSVRSQPHT
DMPRISKVSTAGHKVDKGTERRTAQQPDKTKNKKRPLPGHSHSSFKEMHQRNSSRGSTGG
RNYRM
NT seq 558 nt   +upstreamnt  +downstreamnt
atgactagcgctctttcctctcagtggcatttatgtgatgtcttcaagagtgcgatgtgc
tgtatctcctgtagccacaccctctcgctactgctgtgcatcctcaccctgactccgacg
acaacaggggcgttcccagagaccctgtgcggggcggagctggtcgacacgctgcagttt
gtgtgtggagagagaggcttttatttcagtaagccaggctatggctccagtacacgacgg
tcacgtggcattgtggatgagtgctgcttccaaagctgtgagctgtggcgtctggagatg
tactgcgcacctgccaagactagcaagccggctcgctctgtgcgttcacagccccacaca
gatatgccgagaatatctaaggttagtaccgcagggcacaaagtggacaagggcacagag
cgtaggacagcacagcagccagacaagacaaaaaacaagaagagacctttacctggacat
agtcattcatccttcaaggaaatgcatcagagaaactcaagtcgaggcagcacaggtggc
agaaattacagaatgtag

KEGG   Monopterus albus (swamp eel): 109971005
Entry
109971005         CDS       T05607                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04068  FoxO signaling pathway
malb04114  Oocyte meiosis
malb04115  p53 signaling pathway
malb04150  mTOR signaling pathway
malb04510  Focal adhesion
malb04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971005
   04068 FoxO signaling pathway
    109971005
   04150 mTOR signaling pathway
    109971005
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109971005
   04115 p53 signaling pathway
    109971005
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109971005
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109971005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109971005
Cytokines and growth factors [BR:malb04052]
 Growth factors
  Growth factors (RTK binding)
   109971005
SSDB
Motif
Pfam: Insulin Phospholip_A2_1
Other DBs
NCBI-GeneID: 109971005
NCBI-ProteinID: XP_020474651
LinkDB
Position
Unknown
AA seq 227 aa
MRTERREETLALRSSPPAYKTPGLLKSVHTDRMHSPSRPPATTQTLKVFCVRICVFYSIM
CLAGWPVSSEAARLRCGSDLLSDLIFVCGDRGIYLGKGKWSGYGTRPRGKGIVDQCCRPA
GCELQHLELYCAKPKSQQYTTAYPAMTTASHTTTQTAMEKQFEAVFQKRLLGHLGAPNSP
KREAYRKTQPSLQQRSKVSSSHRRIKNTRSTTSRPPSALQRTMRSES
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagaactgagcggagggaggaaaccttggcgctgcggtcctcccctcctgcctataag
accccgggtctcctgaagtcggtccacactgacaggatgcactcgccaagccgccctcct
gccacaacccagacgctgaaggtgttctgtgtccgaatatgtgtgttctattccatcatg
tgtcttgcgggctggccggtgtcctcagaggcagccaggcttcgctgtggttctgatctc
ctcagcgacctcatatttgtgtgtggggatcgtggaatctatttaggtaaaggtaagtgg
tctggttacggcacgcggcccagagggaaggggatagtagatcagtgctgccggccagct
ggctgtgaacttcaacatctggagctgtactgtgctaaaccaaagagccagcagtacacc
acagcttacccagccatgaccacagcatcacacaccaccacacagacagccatggaaaag
cagtttgaagcagtatttcagaagagactcttggggcatctaggcgctcccaacagtcca
aaaagggaagcatatagaaaaacacagccgtcacttcaacagagaagcaaagtttcatca
tcacacaggaggattaaaaacacacggagcacaaccagcaggcctccctcagcccttcaa
agaacaatgagatctgaatcatga

DBGET integrated database retrieval system