KEGG   Monopterus albus (swamp eel): 109967859
Entry
109967859         CDS       T05607                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04110  Cell cycle
malb04115  p53 signaling pathway
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04340  Hedgehog signaling pathway
malb04371  Apelin signaling pathway
malb04510  Focal adhesion
malb04530  Tight junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109967859 (ccnd1)
   04340 Hedgehog signaling pathway
    109967859 (ccnd1)
   04371 Apelin signaling pathway
    109967859 (ccnd1)
   04068 FoxO signaling pathway
    109967859 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109967859 (ccnd1)
   04115 p53 signaling pathway
    109967859 (ccnd1)
   04218 Cellular senescence
    109967859 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109967859 (ccnd1)
   04530 Tight junction
    109967859 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 109967859
NCBI-ProteinID: XP_020469376
LinkDB
Position
Unknown
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDINLLNDRVLHTMLKAEESYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLNKLKWDLASVTSHDFIEHFLSKLKIYPTTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDTSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHSSTTESKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgcgaggtggactccatccggagagcctaccaggacatc
aacctgctcaacgaccgagtcctgcacaccatgctgaaggcagaggaaagctacctaccg
tcaccaaactacttcaagtgtgttcagaaagaaattgtacctaaaatgaggaaaatagtt
gcgacctggatgttagaggtctgcgaggaacagaaatgtgaggaggaggtttttccgctg
gctatgaactatttggacagatttttatcagtggaggccaccaggaaaacacggctacag
ctgttgggagctacatgcatgtttctagcatccaagatgaaggagactgtccccttaacg
gcggagaaactttgtatctacacggacaactcggttcagcctggagaactgctgcaaatg
gaactgctggttctcaacaagttgaagtgggatctggcttcagtcacctctcatgacttc
attgagcatttcctctccaagctgaagatctacccaaccaccaagcagatcctcaggaaa
catgcccaaacctttgtggctctctgtgctacagatgttaacttcatcgccagtcctccg
tctatggtggcggcaggcagtgtggtggcagctgttcaaggtctctacctgaagagccaa
gatacctccttgtcctcccagaacctcaccaacttcctgtcacaggtcattcgcagtgac
ccggactgcttacggtcctgtcaggagcagatagagtctctgttggagtccagcctgcgg
caggctcagcagcacagcagcacaacagaatccaaacgtgtggacgaggacgtggacctg
tcctgcaccccgacagacgtcagagacatcaacatctga

DBGET integrated database retrieval system