KEGG   Monopterus albus (swamp eel): 109968325
Entry
109968325         CDS       T05607                                 

Gene name
siva1
Definition
(RefSeq) apoptosis regulatory protein Siva isoform X1
  KO
K22744  apoptosis regulatory protein Siva
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109968325 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 109968325
NCBI-ProteinID: XP_020470161
LinkDB
Position
Unknown
AA seq 233 aa
MCTPKLYREQQHVTTAAVGLALSFHVTVNYAFDWFLAASFTLSPPQQISVEASRRKTGLL
AVKMTKRPCPFPETFSSQYKMHIGQQELRNYGVFGNKCRHEIYEKTKTLLFNGAKAVMGK
ICTGEETCRNLRPKGPAQTPACTQMLLRGQTLIRPDGRLTRVNAAQVTPVAPTGCCVCQK
SQVSRTPCSQCDRPVCSSCTRQCSTCSSLCCSFCTIIDYNGRYDEVLCCSCSM
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtgtacccctaagctttatagagaacaacagcacgtgacaacagcagctgtcggattg
gctttgagctttcacgtgacagtaaattacgcgtttgattggttccttgctgcttcgttt
acactttcccccccgcaacaaataagtgtggaagctagcaggaggaagacgggactttta
gcagttaaaatgacgaaacgaccgtgtccgtttccagaaacattctcatcgcagtacaaa
atgcatatcggacagcaggaactgaggaattatggcgtgtttggtaacaaatgcaggcat
gaaatttatgaaaaaacaaagacgttgctctttaacggtgccaaggctgtgatgggcaaa
atatgcactggtgaggagacctgcagaaacctccggcccaaaggaccagctcagacacct
gcatgcacccagatgctgctgaggggacagacactcattagacctgatgggagactgaca
agagtaaacgctgcacaggtgacaccagtggctcctacaggctgttgtgtgtgtcagaag
agccaggtgtccagaacaccatgctcccagtgtgaccgtccagtgtgttcctcctgcacc
cgacagtgctccacctgctccagcctttgctgctctttctgcaccatcatagattacaat
ggacgatatgatgaagtattatgctgcagttgttcgatgtaa

DBGET integrated database retrieval system