KEGG   Monopterus albus (swamp eel): 109969432
Entry
109969432         CDS       T05607                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04137  Mitophagy - animal
malb04210  Apoptosis
malb04218  Cellular senescence
malb04620  Toll-like receptor signaling pathway
malb04621  NOD-like receptor signaling pathway
malb04622  RIG-I-like receptor signaling pathway
malb04623  Cytosolic DNA-sensing pathway
malb04625  C-type lectin receptor signaling pathway
malb04920  Adipocytokine signaling pathway
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109969432 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109969432 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    109969432 (rela)
   04218 Cellular senescence
    109969432 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109969432 (rela)
   04621 NOD-like receptor signaling pathway
    109969432 (rela)
   04622 RIG-I-like receptor signaling pathway
    109969432 (rela)
   04623 Cytosolic DNA-sensing pathway
    109969432 (rela)
   04625 C-type lectin receptor signaling pathway
    109969432 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109969432 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109969432 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109969432 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109969432 (rela)
Transcription factors [BR:malb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    109969432 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 109969432
NCBI-ProteinID: XP_020471975
LinkDB
Position
Unknown
AA seq 633 aa
MAGVYGWGLTPFNQGVQTANPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTH
PAIKVHNYNGPLRVRISLVTKNPPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQ
CVKKKDVNEAITCRLQTNNNPFSIAEAKVWEEEFDLNSVRLCFQASITLPTGEPFPLEPV
VSQPIYDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGT
FSQADVHRQVAIVFRTPPYRDTNLAEPIRVKMQLRRPSDREVSEPMDFQYLPADPDEYRL
SEKRKRTGDMFQSLKLGPMLSSVSIPQDRRHLSPARRTVTAKPPSINAQAGVVVPPAAIG
VKPQPTYSFNQPGQLFSVQHKVEASPSISAATTNQTWKIMESLNLGPQPKATPVSSFTMN
QAPSSSFSTPTSTANQEYSTVSLMDLHEFFPNISSGMTQEPAASQASTVSKASSTFPLQG
SQLRVDVPLADDIPELPSFSEEQAPGTLDSLNMDDLVDFLTPPLMNEGENGTSMLAQASC
QQAAPHGSTTAAQNRAVSQNTSDPAGNPGSTWMNYPNSIVNLLQNENMVVLASSNQRSAV
LDEFDELMSADEDRLISIFNSESQVGFVSGPPT
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggctggtgtatatggatggggcctgaccccattcaaccaaggagtccaaacagcaaac
ccctacatagagatcatcgagcagccaaagcagagggggatgaggtttaggtacaagtgt
gagggacgttcagctggcagcatccccggagagaaaagcaatgacaccactaagacccac
ccggccattaaggtgcataactacaatgggcccctgcgtgttcgcatttcattggtaaca
aaaaacccaccgtataagccccaccctcatgaactggttgggaaagactgcaaacatggc
tactatgaggctgacctccaagagagacgaatacacagttttcagaacctgggcatacag
tgtgtcaagaagaaggatgtgaatgaggccatcacttgcagactacaaaccaataataac
cccttcagtattgccgaggcaaaggtgtgggaggaggagtttgacctgaattcagttcga
ctttgcttccaggcctccataactctgccaacaggggagccatttcctctggagcccgtg
gtatcacagcccatctatgacaacagggccccaaacacagctgagctgaagatctgccga
gtcaaccgcaactctggaagctgcaaaggaggggatgaaatctttctgttgtgtgataaa
gtacaaaaagaggacatcgaggtgcgtttcttccaggactcctgggaggggaagggcact
ttctctcaagctgatgtccacaggcaggtggccattgtgttccgcacaccaccctaccgt
gacactaacctcgctgagcccattagagtcaagatgcagctccgccgcccctctgaccgc
gaggtcagcgaaccgatggacttccagtacctgccagctgacccagatgaatacaggctg
agtgagaagagaaagcgtacaggagacatgttccagagcttgaagctggggcctatgctg
tctagtgtgtccattccacaagatagacggcacctaagcccagcaagaagaacggttaca
gccaaacctccatcaatcaatgcacaagctggagttgtggtgccccctgctgccattgga
gtgaaaccccagcccacctactcattcaatcagccaggccagctcttctcagtccagcac
aaggtagaggcctccccctctatctctgctgcgactacaaaccaaacttggaagatcatg
gagagcctaaacctgggtccccagcccaaagccactccagtgtccagcttcacaatgaac
caggcaccatcctcctccttctctactcccacctccactgccaaccaagagtactcaact
gtcagcttgatggaccttcatgaattcttccccaacatttcctcgggcatgacccaggag
cctgcagcttcccaagcaagcacagtctccaaggccagcagcaccttccccctccagggt
tcccagttgcgagtggatgtgccactcgcggacgatatcccagagctccctagcttttct
gaagagcaggccccaggaaccctggacagcctaaatatggatgacttggtggactttctg
accccccctctcatgaatgagggtgaaaatggcacctcaatgttggctcaagcttcgtgt
cagcaagctgccccacacggctccaccactgctgcccagaacagagcagtatcccagaac
acttctgaccctgctggcaacccaggaagtacctggatgaattaccccaacagcatcgtc
aacttgctccagaatgagaacatggttgtcctcgcatccagcaaccagcggtctgcagtg
ctcgatgagtttgatgagttgatgtccgccgatgaggatcgccttatttccatttttaac
agcgaaagccaagttgggtttgtgtcaggacctccaacctaa

DBGET integrated database retrieval system