KEGG   Monopterus albus (swamp eel): 109969876
Entry
109969876         CDS       T05607                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type protein 3 isoform X1
  KO
K10137  zinc finger, matrin type 3
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109969876 (zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-U1 TUTase zf-C2H2_2
Other DBs
NCBI-GeneID: 109969876
NCBI-ProteinID: XP_020472729
LinkDB
Position
Unknown
AA seq 487 aa
MMALQLRNGDAAYYQSAQYYRNYTSPPVSYGDSSHYLARLPGPETMLKPPLTLFSHSQQP
FRHMDSLHQLGPLPMAPMQPLGPPPIAPAQAIGPPTMAPTQTLGPPPITAAHTLRPAPIT
PPHTLGPPPISPAQPLGPPSMAHTLGPPPLDHTQAIVPPTMDLTQSLGHPPLNPAQTLVP
GSGQFPLPPSPMSSPPAPGPDPSHLPPRPPVTALIPSSVSGIIPLPGQAAPVSELPQDEG
SPVGTEEQEDSLGLEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHSKKLRNFYAGSQQPT
SIRIPEVLEAAGQAAPSSGSSDSDTGRQALYKGVTRVILATENDYCKLCDASFSSPAVAQ
AHYQGKNHAKKLRLAEAQHNSNNMDSSNEAPPRRNRKDGSEYRLVKNRRSPQLPASMPGP
YYNPRPRQRIPRDLAMCVTPSGQFYCSMCNCGAEQETDFRQHLESKQHKAKMSELRYRHE
MENLGYS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatggcgctgcaactgaggaacggggatgcagcgtattaccagagtgcacagtactac
agaaattacacttcgccgccggtcagctacggtgacagcagtcattatcttgcccgactg
ccaggtccagaaaccatgctgaagcctcctctgactctcttcagccattcccagcagcct
ttccgacacatggattctctgcaccagctgggaccgctgccgatggcacctatgcagcct
ctcggcccaccacctattgctcctgctcaggcaattgggcccccaactatggctcccacc
cagactctaggacctcctcccataactgctgctcacacattaaggcctgcccccattact
ccaccacataccttaggcccccctccaatatctccagctcagccactgggccctccatcg
atggcacacacattgggtcccccacctctagatcacacacaagcaatagtgcctccaact
atggacctcacacaatcactggggcatccacctttgaaccctgcacaaacactggtcccc
ggatctggtcagttcccccttcctcccagccccatgtcctcccctcctgctccaggccca
gacccttcacacctgcccccaaggcccccagtaacagccctcatcccatcctcggtgtct
ggcatcatccctcttccaggccaggcagccccagtcagcgagctgccccaggatgagggc
tctccagtggggacggaggagcaggaggactctctgggactggaggaactgtgcaaacct
ctctactgtaaactctgcaacgttaccctcaactccgctcagcaggcacaagctcactac
cagggaaagaaccacagtaaaaagttaagaaatttctacgctggcagtcaacaacctaca
tccatcaggatcccagaagtcctcgaggcagctggccaggcagcccccagctcaggatcc
agtgacagcgacacaggcaggcaggcactgtataagggggtgacgcgggtcatcttggcc
acagagaacgactactgtaaactgtgtgatgcctcattcagttcgccggcagttgcgcag
gcccactaccagggcaaaaaccacgccaagaaactacggcttgctgaggcccaacacaac
tccaataacatggacagcagcaatgaggcacccccaagaagaaacaggaaggatggcagc
gagtacagactggtgaaaaaccgccgcagcccacagctaccagcttctatgccaggccca
tactacaaccccagaccgaggcagcgcatccctagagacttagccatgtgcgtgactccc
agcggacagttctactgctccatgtgcaactgcggagctgagcaggagacagacttcagg
cagcatctggagagcaagcaacacaaagctaaaatgtcagagttaagataccgccacgag
atggagaaccttggctacagctaa

DBGET integrated database retrieval system