KEGG   Monopterus albus (swamp eel): 109969980
Entry
109969980         CDS       T05607                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04210  Apoptosis
malb04620  Toll-like receptor signaling pathway
malb04621  NOD-like receptor signaling pathway
malb04622  RIG-I-like receptor signaling pathway
malb04623  Cytosolic DNA-sensing pathway
malb04625  C-type lectin receptor signaling pathway
malb04920  Adipocytokine signaling pathway
malb05132  Salmonella infection
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109969980
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109969980
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109969980
   04621 NOD-like receptor signaling pathway
    109969980
   04622 RIG-I-like receptor signaling pathway
    109969980
   04623 Cytosolic DNA-sensing pathway
    109969980
   04625 C-type lectin receptor signaling pathway
    109969980
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109969980
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109969980
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109969980
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109969980
Protein kinases [BR:malb01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   109969980
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 109969980
NCBI-ProteinID: XP_020472893
LinkDB
Position
Unknown
AA seq 615 aa
MVQPQPDCPMQWDMSGEESVVALRVPPELAANEVVSRLLGDNQQLREALRRSNLALRQRC
EELEGWQQRAREEREFLSCRFQEARALVERLAQENHSLQGLVNGPASSSSHCCSSSQTED
LQGHTVRNGPLDGPQTLDQRERKRVEEMDQHTQTMPPRSLDDDSVHSYLSSILPTPTSLS
ESVGREDSVPLEGANEFLQLLKSHKEKMEEGMRDLRRKNEELEKEKEEGEKEREQMHHCI
EQLRAKLAQAQVNSVAEEALQHRSEAQHSSDCSSLAKLTEQLQATQGRYRELEEKLDYLQ
KSSAQRDRTEALLKQKDKDCAQLAKDCEALKAQATSLLGELNERQTCLEKSEQERKQLEE
KLCSKVKSLQVAERELEQQRKQHHVAMDKLLLQKDNLEHALKTERHVVTEEKKKLTQLQH
AYTCLFRDYDSKLKNEGGDLCSRLEEAERALALKQDLIDKLKEEVEQQKGSLETVPVLTA
QAEIYKADFLAEREAREKLNQKKEELQDKLTQALAEIDRLKREVTARACMEQMKLRHLED
FPARAPHVPPQQGVFPGPAFNTVPPAPSFRNQGLVPVGDQGAAGAEELPDLCCPKCKYQA
PDMDTLQIHVMDCIQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggtgcagccccagcctgactgcccaatgcagtgggacatgtcgggagaggagagtgta
gtggccctcagggtcccaccagagctggctgcaaatgaagtggtgagcaggctgctgggg
gacaaccagcagcttagagaggccttgcggcggagcaacctagccttgcgtcagcgttgc
gaggagttggagggatggcaacaaagggcgagagaggaaagagaatttctcagctgtcgt
ttccaagaggccagggccctagtggagaggctggctcaggagaatcactctttacagggc
ctggtgaatggcccagcctcctcttccagccactgctgcagctccagccagactgaagac
ctacaggggcacacagtgaggaacggcccgctggatggaccacagactctagatcagcgg
gagaggaaaagagtcgaagagatggatcaacacacacagaccatgccacctcgcagcctg
gatgatgacagtgtgcatagctacttgagtagcatcctccccactcccacctcactttca
gagtcagtgggcagggaagatagcgtgcccttggaaggcgcaaacgagttcctgcagctg
ctgaagagccataaggaaaaaatggaggaagggatgagagacctgaggaggaagaatgag
gagctagaaaaggagaaggaggagggagagaaagagagagagcagatgcatcactgcatt
gaacaactacgagccaaactggcccaggcgcaggtgaacagtgtcgctgaggaggcactt
caacatcgctccgaggcacagcactcctctgactgctctagcctggctaaactcaccgag
cagcttcaggccacacagggcaggtatcgggagctggaggagaagcttgattacctgcag
aagagttcagctcagcgggacagaactgaagctctgctcaaacaaaaggataaggactgt
gctcagctggccaaggactgtgaggctctgaaagctcaagcaacttccctattaggagag
ctgaatgagagacagacctgcctggagaaaagcgagcaggaacgcaaacagctagaagaa
aagctgtgcagtaaggtgaagtccctgcaggtggcagagcgggagctggagcaacagagg
aagcagcatcatgtggccatggacaagctgctgctgcagaaggacaacctggagcatgcc
ctgaagacagagagacatgttgtcacagaggagaagaaaaaactgacacagctgcagcat
gcctacacatgtctctttagagactatgattcaaagctgaagaatgagggaggggatttg
tgtagccgactggaggaggcagagcgagcgctggccctgaagcaggatctaattgataaa
ctgaaggaggaggtggagcaacagaaaggttcgctggagaccgttcctgtcctcactgca
caggctgagatctacaaggcagatttcctagcggagcgagaagccagagagaagctgaac
cagaagaaggaggagcttcaggataaactgactcaggccctggctgagattgacaggctc
aaacgggaagtcacagcacgtgcatgtatggagcaaatgaagctgagacacctggaagac
tttccagcacgagccccacacgttcccccccagcaaggtgtgttccccggtccagctttt
aacacagtgcctccagcgccctcgttccgcaatcagggtttggtaccagtcggtgatcaa
ggggcagctggagctgaggagctgccagatttatgttgtcctaagtgcaagtaccaggct
ccagatatggacacgctgcagatacatgtcatggactgtatacagtaa

DBGET integrated database retrieval system