KEGG   Monopterus albus (swamp eel): 109970226Help
Entry
109970226         CDS       T05607                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1-B-like
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109970226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109970226
Enzymes [BR:malb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109970226
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109970226
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109970226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Tudor_4 DUF5604 TUDOR_5 Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 109970226
NCBI-ProteinID: XP_020473298
LinkDB All DBs
Position
Unknown
AA seq 1264 aa AA seqDB search
MENSEGMEVEGWDSGLEEELGISLDELKKWIEDAVEKSELVQKKKTQLAEMREWVEKKEE
EAAMTEKLLKDANQSMLECESLVKAAYRKNGLVYRESSSEDEGGGGRPLSSEVIEIDDDD
DDDVIAVGCLVPPKKPLTAGKDPVLQDAAAALQKTSQQMQKLVQIVSKPSPGAPFLRSTG
QPPAQSGMQGSAPAVFVSQVSSQSITKPSPNITEDELRVGMSILGKKRTKTWHRGTLVAI
NPVGNGIFKYKVKFDKGKSLLSGNHVAFDYNPTLESLYVGARVVAKYKDGNLVWLYAGIV
AEMPNNKNRMRFLIFFDDGYASYVTLPELYPVCRPLKHTWEDIEDASCRDFIEEYITAYP
SRPMVLLKVNQIIKTEWDGTWWKSKVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNL
KMTTANNQEKKLAGQQRTRPNMGALRSKGPVVQYTSDGHVGVSPIKAPQAPPSHPSQTPQ
LQPRPQPQQTQQTPQPAQAMQPPQTPQAPQPPQAPQALQPPQAPQLQQLPQPPRADNKHQ
MAKKSTTPFVPGVGGTHASKVMQSLSSSPSNLSSGRILMTPPFTQQYQRQMPSLAPAPPP
IINTMATIPHQPSYRAPTDRIFYLAHTCQPACLNRVRPAKPDIHRGKNPLLTPLLYDFRR
MTGRRKVNRKMSFHVIYKAPCGLCLRNMAEIQRYLFQTHCDFIFLEMFCLDPYVLVDRPF
QPQRPFYYSADITSGREDIPLSCVNEIDSTPPPKVAYSKERIPEDGVFINTSSDFLVGCD
CTDGCQDKFKCSCHQLTLQATACTPGGQINPNAGYLHKRLEECLPTGIYECNKMCKCSHQ
MCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVAKGSFVCIYAGKILTDDFADKEGLEMG
DEYFANLDHIESVENFKEGYESEAHCSDSEGSGVDISRIKIQPSALVSSNPIGRLPRKGE
SQSKETTSSSGDSSDDDEKDSKSEDESDSSDDTFVKDSYYSSSSVWRSYTTRGQVKGNKE
GSQDSKDGLTASAKGTDDEKPPSMPEETGKSKVASWLTNQGLKKEESGDSKSQVKSETGK
KQDVMSLSDSDDVQTISSGSEDKXXXXXTASGVTKKQVAVKSTRGIALKSSHGLVVKTGG
GGGGGPGGHGGKPGQSGQTGPGGENAPKNTRQFFDGEESCYIIDAKLEGNLGRYLNHSCS
PNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECR
GRLL
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagtgaaggaatggaggtggagggttgggactctggtctggaagaagaactg
ggcatttctttggatgagctgaagaagtggattgaagatgctgtggagaagagtgagctc
gtgcaaaagaaaaagacacagctggcagagatgagagaatgggtggagaagaaagaagag
gaagcagcgatgacagagaagcttctcaaagatgccaaccagtccatgttagagtgtgag
agcctggtgaaagcggcctaccggaaaaatggtcttgtgtatcgagagagcagctcagag
gatgaggggggcggaggacggccgctgtcctctgaggtcattgagattgacgatgacgac
gatgatgatgtcattgctgttggctgtttggttcctccaaagaaacctcttactgctggc
aaagatccagtgttacaagatgctgctgctgctctacagaaaacctctcagcagatgcag
aagttggtccaaattgtcagcaagccctcaccaggtgctccatttctcagatccacggga
cagcccccagctcagtcaggtatgcaaggttcggcacctgcagtgtttgtgtcccaggtt
tcatctcagtccataaccaagccaagcccaaatataacagaagatgagctcagagtcggg
atgagcattctgggaaagaaacgcacaaagacctggcacagaggcacccttgttgctatc
aaccctgttggaaatggtatattcaaatataaagtgaaatttgataaaggaaagagtctg
ctctctggaaatcatgtggcttttgactataaccctacactggagagtctgtatgtcgga
gcccgtgtagttgccaagtacaaggatggcaacctggtgtggctctatgctggaatagta
gctgagatgcccaacaacaagaaccgcatgaggtttctgatattctttgatgatggctat
gcttcatatgtgacactacctgagctctatcctgtttgccgaccactaaaacatacctgg
gaggacatagaagacgcatcatgtcgagacttcatcgaggagtacatcactgcctatccc
agcaggcctatggttctcttaaaggtcaaccaaataatcaaaacagagtgggatggaacc
tggtggaagagcaaagtagaagaggtggatggcagcttggtcaagatcctttttttggat
gataagaggagtgagtggatctatagaggctccaccaggttggaaccaatgtttaacctg
aaaatgaccacagccaacaatcaggagaagaagcttgctggtcagcagaggacacgacct
aacatgggggcattgaggagtaagggcccagtagttcaatacaccagtgatggacatgtt
ggagtctcacccatcaaagcaccacaggccccacccagccatccttcacagaccccacaa
cttcaaccacgtcctcagccccaacaaacccagcaaacacctcagccggcacaggccatg
cagcccccacagactccacaggctccacagcccccgcaggctccacaggctctgcagccc
ccacaggctccacagcttcaacagcttccccagcctccacgtgccgacaataaacatcag
atggcaaagaagagcactactccgtttgtcccaggcgtgggaggcacacacgcctccaaa
gtcatgcagtctctttcctccagtcccagtaatctgtctagtggaaggatattgatgaca
ccccctttcacacagcagtatcagaggcagatgccgtctctggctcctgccccccctcct
ataatcaacacgatggccaccatcccacatcagccttcctatcgagccccaaccgaccgc
atcttctacttggctcacacgtgtcagcctgcctgtctgaatcgtgtacgacctgcaaaa
ccagacatacaccgaggaaagaaccccctcctcacaccattactgtacgatttcagacgc
atgactggacgacgcaaagtcaaccgaaagatgtctttccatgtcatctataaggctcca
tgtggcctttgtctacgtaacatggcagagatccagcgctacctcttccagacgcactgt
gactttatattcttagagatgttttgtctagacccctacgtacttgtggaccgccccttc
cagccacagaggccattctattacagtgcagacatcaccagtggaagagaggacatcccg
ctgtcctgtgtcaacgagatcgattccaccccccctcctaaagtagcctatagtaaagag
cgtattcctgaagatggggtattcattaacaccagttcagactttctggttgggtgtgat
tgcactgatggttgtcaagacaagttcaagtgctcctgccaccagctgacccttcaggct
acagcttgtacaccagggggacagatcaacccaaatgccggatatttgcacaaacgatta
gaggagtgccttcctacagggatctatgagtgtaataagatgtgcaaatgttctcatcag
atgtgcaccaaccgcctggtgcaacatggtttgcaggtgcgtcttcagctcttcaagacc
cagaataaaggctggggcatccgctgtctggatgatgtggccaaaggctcttttgtctgc
atctatgctggtaaaattttgacagacgactttgctgacaaagaaggtttagagatgggg
gatgaatattttgctaacctggatcatatagagagtgtggagaacttcaaggagggctat
gagagtgaggcccactgttcggacagtgaagggagtggcgtggacatttccaggatcaaa
atccagccatctgctttagtgtcatctaaccctattgggcgtttacccagaaagggtgag
tctcaatccaaagaaaccacaagctcatcgggcgacagcagtgatgatgatgagaaagac
tctaagagtgaagatgaaagtgacagttcagatgacacatttgtgaaggatagttactac
agctccagctctgtgtggaggagttacactacacgtggccaggtcaagggcaacaaggaa
gggagtcaagacagtaaagatggactcactgcatcagccaaaggaaccgatgacgagaag
ccaccatcaatgcctgaggagacaggaaaaagcaaagtggcttcctggcttaccaaccaa
gggctgaagaaggaggaatctggagacagcaagagtcaggtgaagtcggaaacagggaag
aagcaggatgtgatgtctctgtctgacagtgatgatgttcagactataagctcaggatct
gaagacaaggnnnnnnnnnnnngtactgcctcaggtgtgacaaagaagcaggtagcagtt
aaatctacacgtggcatcgctttgaagtccagccacgggctggtagtgaaaacaggagga
ggaggcggaggagggcccgggggtcacggaggaaaacctggacagtcgggacagactgga
cctggcggggaaaatgctcccaaaaacacccgccagttctttgacggtgaagagtcgtgc
tacatcattgatgctaagttggaaggcaaccttgggcgttacctcaatcacagctgcagc
cctaatctctttgtccagaacgtatttgtggacacacatgacttgcgcttcccctgggtg
gcgttctttgccagcaagcggatccgggccggcaccgagctgacctgggactacaactat
gaggtgggcagcgtggagggcaaagagctgctttgctgctgtggatccactgagtgcaga
ggaagattgctgtaa

DBGET integrated database retrieval system