KEGG   Monopterus albus (swamp eel): 109970537
Entry
109970537         CDS       T05607                                 

Gene name
tp73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109970537 (tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109970537 (tp73)
Transcription factors [BR:malb03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    109970537 (tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 109970537
NCBI-ProteinID: XP_020473804
LinkDB
Position
Unknown
AA seq 657 aa
MSQSTVTEEGGTFEHLWSSLEPDSTYFELPPGSQPGERPVPSASTPGSHHSAAEVSMDVY
HMRDMNDNVMSQYNLLSSSMESLGSRATSASPYSSENAPSSAVPTPSPYSQPNSTFEGLS
PAPAIPSNTDYPGPHAFQVSFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLSSSPP
HGSIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQAAPASHLIRVEGNNLCQYVDDPV
TGRQSVFVPYEAPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRRSF
EGRICACPGRDRKADEDHFREQQAMNESVAKNGSANKRNFKQSPSNIPSPNINMRKRRHG
EEELFYIPVRGRENFELLMKIKDSLELVELVPLPLVESYRQQAQQQLLQRPSHIASPSSY
SPLSNMNKLHTHGGLSKSPSVNQLVGQQPQQHTTAPTSIAHMGSNMLNSHHMQASGDMNG
GHSSHTIVSASHCSPPPPYNPDPSLVSFLTSLGCQNFIEYFASQGLQSIYHLQTLSMEDL
GALKIPEQSRLAIWRGLQDMKQGASLQLPASTHHHDYHGQQLLRSSSNMAASARVMEAVH
FRVRHTITIPNRSGVVGTSGMAAATDEWADFGFDMPDCKVSRNKHSIKEEFLESDVH
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgtcccagtccactgtcaccgaagaaggaggcaccttcgagcacctgtggagctccttg
gagccagacagcacctactttgagctccccccaggcagtcagccaggtgagaggccagtg
ccttctgccagtaccccagggagccaccacagtgctgctgaggtgtccatggatgtctac
cacatgagggacatgaacgacaatgtgatgtcccagtacaacttgctgagcagcagcatg
gagagcctggggagccgtgcgacgtccgccagcccctacagctcggagaacgccccctcg
tcggccgtgcccaccccctctccctactcccagcccaactctacctttgagggcctgtcg
cctgccccggccatcccctccaacactgactaccctgggccgcacgctttccaggtgtcc
ttccagcagtccagcaccgccaagtctgcaacttggacctactctccactgctgaagaaa
ctctactgccagattgcaaagacctgtcccatccaaatcaagctgtcctcctctcctcca
catggcagcatcatcagagccatgcctgtctacaagaaggcggagcacgtcacagaagtg
gtcaaacgctgccccaatcatgaattaggcagagacttcaatgatggtcaagcagccccg
gccagtcacctgatccgagtggaggggaataatctctgtcagtacgttgatgatcccgtc
actggccgacagagcgtcttcgtgccctatgaggctccacaggtggggactgagtttacc
accattctgtataacttcatgtgcaacagcagctgtgtgggtggcatgaacaggagaccc
atcctcatcatcatcactttggagaccagggatggtcaagtgttgggcagaaggtcattc
gaaggtcggatatgtgcgtgtcctggccgagaccgcaaagccgacgaggaccacttcagg
gaacaacaggccatgaatgagagcgtggccaaaaatggcagtgccaacaagcgcaacttt
aaacagagtccgtcaaatattcccagtccaaatattaacatgagaaagaggcggcatgga
gaagaagagcttttctatattccagttcgtggtcgggagaattttgagctgctgatgaag
attaaagacagcttggagctggtggagttggtgccactgccactggtagaatcctacaga
caacaagcacagcagcaactgctgcagagaccgagccatatagcatccccctcctcctac
tccccactgtccaacatgaacaagcttcatacccacggtggcctcagcaaatcgccctca
gtcaaccagctggtgggacagcagccccagcaacacaccactgcgcccacctcaatagct
catatggggtcaaacatgctcaacagccaccacatgcaggccagtggtgatatgaatggt
ggtcacagcagtcacactatagtgtctgcttcccactgcagcccgccccctccatataac
cctgaccccagcctcgtcagttttctaaccagtctgggctgtcagaacttcattgagtac
ttcgcctcccaaggtctccagtctatctaccatctgcagactctctccatggaggattta
ggtgcactgaagataccagagcagtcccgccttgccatctggcgaggtctgcaggacatg
aaacaaggtgcttccctccaactgcctgcctctactcatcatcatgactatcatgggcag
cagcttcttcgctccagcagcaacatggctgcctctgcccgtgtcatggaggctgtgcac
ttccgtgtccgccataccatcaccatacccaacaggtcaggtgttgttgggacatcaggg
atggcagcagcaactgatgagtgggctgactttggtttcgatatgcctgactgtaaggtg
tcacgcaacaagcactccatcaaagaggagtttctggaaagtgatgttcactga

DBGET integrated database retrieval system