KEGG   Monopterus albus (swamp eel): 109970848
Entry
109970848         CDS       T05607                                 

Definition
(RefSeq) protein shisa-5-like
  KO
K10135  scotin
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109970848
SSDB
Motif
Pfam: Shisa Comm ETRAMP
Other DBs
NCBI-GeneID: 109970848
NCBI-ProteinID: XP_020474398
LinkDB
Position
Unknown
AA seq 256 aa
MVSGLSGVLVVALCVLLSPCVSGDDNDCKSYRDEFGTYHSSKECPYSFCCGSCTRRYCCV
NNFMQFSEDEQTQCDTLSPSSYPDPRLQLPLILGPLLFILLIIIICCICPCCCLYKMCRK
PRPVIATTTHTTVVTTNQQRYPQQPTAAPGHPQGYQAVQYPPYQPVPVQPGYGAQPMPAL
PYPAQPFTPGPPPTYQEATVPGYPPNPMPYSHAAFTPGHPAYPPQPPVQPQSSAPPMHTD
YLAQPAYNPEYVAPHP
NT seq 771 nt   +upstreamnt  +downstreamnt
atggtgtccggcctgtccggtgttcttgtggtggctttatgtgtgctcctgtcgccctgc
gtatctggggacgacaatgactgtaaatcctacagagatgaattcggaacttaccattca
tccaaggaatgtccatattcgttttgctgtggtagctgcaccagaagatactgctgtgtt
aacaacttcatgcagttttctgaggatgaacagactcagtgtgacaccttatctcccagt
agttacccagatcctagattacaattacctttaatccttggtcctcttctcttcattttg
ctcatcatcatcatttgctgcatctgtccctgctgctgcctgtacaagatgtgccgcaag
ccccgacctgtgattgcaaccaccacccacaccacagtggtcaccaccaatcagcagcgg
taccctcagcagccaactgcagcaccagggcatcctcagggttaccaggcagtccagtat
ccgccctaccagcctgtaccagtgcagccgggatatggtgcccaacccatgcctgcactg
ccctacccagcacagccgttcacaccaggaccacctccaacatatcaagaagccacagtt
cctggctaccccccaaacccaatgccttacagccatgctgcgttcacccctggccatcca
gcgtatcctccacagcctcctgtccaaccgcagtccagtgctccacccatgcacacagac
tacctagcccagcctgcgtacaacccggaatatgttgcaccacatccttag

DBGET integrated database retrieval system