KEGG   Monopterus albus (swamp eel): 109971160
Entry
109971160         CDS       T05607                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109971160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109971160
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:malb03310]
    109971160
Transcription factors [BR:malb03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    109971160
Nuclear receptors [BR:malb03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   109971160
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 109971160
NCBI-ProteinID: XP_020474903
LinkDB
Position
Unknown
AA seq 774 aa
MDVGGVRKITYRGDDHLSKLVYTESPEEGGLLKVAPHSAMSITSTTSVVIPSSPLMQPGQ
VPNGLCNSPLSEELTSATVTATVGSLLEDPEHRGLTTDQRSQQQQLLQTQSSATFGRQNL
EVSMTDISQASMDSLIGGSDPSFFPMKTEDFCIDKGDQDPIDLDHAFEHIGKDVNVTPSL
VSDNTLDLLQETELIGSPSDFYVGDDAFLSSLADDSLLGDVVSERFESINSNGAIPIALN
GSIMTSLDQSSTNASTGSPLTPAATLSALVKKEKDAGFIQLCTPGVIKQEKTSAGQSYCQ
LSSMSSTDMASSNPISICGVSTSGGQSFHFGVNPSNSDTEQHKDQKPVTSMFLPVTNIGG
VWNRGQGGGDNSAMQRASEAFSCSPSYPTSFVSSASRPDGGISISSAQGKSKTLKICLVC
SDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMA
GMNLEARKTKKLSRLKGSQPSNQPEVIPPPPVAARSLVPKGMPQLIPTMLSLLKAIEPDT
IYAGYDSTLPDTSTRLMTTLNRLGGRQVVSAVKWAKALPGFRNLHLDDQMTLLQCSWLFL
MSFGLGWRSYQQCNGTMLCFAPDLVINEERMKLPYMADQCEQMLKISNEFVRLQVSHEEY
LCMKVLLLLGTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLD
SMHEMGGGLLNFCFYTFVNKSLSVEFPEMLVEIISNQLPKFKTGSVKPLLFHQR
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggatgtaggtggagtgaggaagataacatatagaggagatgaccatttaagcaaattg
gtctacactgaaagccctgaggagggaggtctgttgaaggtggctcctcacagtgccatg
tccatcacttctaccacctctgttgttattccatccagcccgttgatgcagccaggacag
gtacctaacggcctctgcaacagccccctttcagaggagctcacatccgccacagtcact
gccaccgtaggctccttgttagaagacccagagcacaggggcctgaccacagatcagagg
tctcagcaacagcagttactccagacacagtcatctgcaacatttgggcgtcaaaatttg
gaggttagtatgacagacatttcccaggcctccatggattcacttattgggggatcagat
cccagcttctttcccatgaaaacagaggatttctgcattgataaaggagaccaggatccc
atcgaccttgatcatgcctttgagcacattgggaaagatgtaaatgtgaccccgtcattg
gtcagtgataacactctggacctgctccaagaaactgaactcattgggtccccctcagat
ttttatgtaggagatgatgccttcctgtcctctctggcagatgattctcttcttggggac
gttgtctcagagaggtttgagagcattaacagcaatggggcaatccctattgctctcaat
ggcagcattatgacaagtctggatcagtccagcactaacgcatccacaggctcccctcta
acccctgcagccacgttgtctgcactggtgaaaaaggaaaaagatgctggcttcattcag
ctctgcaccccaggtgtgattaaacaggagaaaacatctgcaggtcagagttattgccaa
ttgagcagcatgtcctccacagacatggctagttctaaccccatttccatctgtggagtg
agcacttcaggaggacagagcttccactttggagttaaccccagcaacagtgatactgag
cagcataaggatcagaagccagtgaccagcatgtttctaccagtaacaaacatcggcggg
gtctggaacagaggccaaggtggtggggacaactcagcaatgcagagggccagtgaggct
ttctcatgctctccctcgtaccccaccagctttgtcagctctgcctccagaccagatggg
ggcatctctatatcctcggcacagggaaaaagcaagactctcaaaatctgcctggtgtgc
tctgacgaggcctcaggctgccactacggcgtcttaacctgtggcagctgcaaggtcttc
ttcaagagagctgtggaagggcagcataattacctgtgtgctgggaggaacgactgcatt
atagacaagatcaggaggaaaaactgcccagcgtgtcgattccgcaagtgtctgatggca
ggcatgaacctggaagcacgcaaaaccaagaagttaagccgcttaaagggcagccagcca
agcaaccaacctgaagtgattcctcctccaccagttgcggctcgctcccttgtacccaag
ggcatgcctcaactcattcccacaatgctgtctctgctgaaggccattgagccggacacc
atctacgccggctatgacagcaccctgcccgacacctccacccgtctgatgaccaccctc
aacaggctgggtggccgacaggtcgtctctgctgtcaagtgggccaaggctctgccaggt
tttaggaacctccacctggatgaccagatgaccttgctgcaatgctcctggctcttcctc
atgtcctttggtctgggctggagatcgtaccagcagtgcaacggcaccatgctttgcttt
gcaccagacctcgtcatcaatgaggagcggatgaagctgccctatatggccgaccagtgt
gagcagatgttgaagatttccaacgagtttgtccggctgcaggtttcccatgaggagtat
ttgtgcatgaaggtcttgctgctgctcggcacagtgccaaaggacggcctgaagagccag
gcggtgttcgacgagattcggatgtcgtacatcaaggagctggggaaagccatagtgaag
cgcgaggagaactccagccagaactggcagcggttctatcagctcaccaagctgctcgac
tcgatgcatgagatgggcggtggactgctcaacttctgcttctacacctttgtgaataaa
tcccttagtgtggagttcccggagatgctggtagagatcatcagcaaccagttgccaaaa
ttcaagactggaagtgtcaaacctctcctcttccatcagagatga

DBGET integrated database retrieval system