KEGG   Monopterus albus (swamp eel): 109971167
Entry
109971167         CDS       T05607                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971167
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109971167
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109971167
   00536 Glycosaminoglycan binding proteins [BR:malb00536]
    109971167
Cytokines and growth factors [BR:malb04052]
 Growth factors
  Growth factors (RTK binding)
   109971167
Glycosaminoglycan binding proteins [BR:malb00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109971167
SSDB
Motif
Pfam: FGF Fascin Ntox17
Other DBs
NCBI-GeneID: 109971167
NCBI-ProteinID: XP_020474909
LinkDB
Position
Unknown
AA seq 157 aa
MTDREVSGLEDQSEDSGLLLRGYRRLTRLYCMNGGHHLQIVPDGTVQGLRDDRDVYTVLK
IKSVNRGVVVIQGTEAGRYLAMNDEGRLYSSPTVTDESYFLEKLEENHYNTYQPQKYQDR
TWYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDDSGE
NT seq 474 nt   +upstreamnt  +downstreamnt
atgacggatagagaggtgtctggactggaggatcagagcgaggacagcggcctgctgctg
cggggctacaggcggctgactcggctgtactgcatgaatggcggacaccacctccagatc
gtccccgatggcacagtgcagggcctcagagatgacagggacgtttacactgttttaaag
ataaaatccgtgaacagaggtgtggtggtcatccaaggaacagaagctgggcgatatctg
gctatgaacgatgaggggcgtttatacagttcacccacagtcactgatgaaagttacttc
ctggagaaactggaggagaaccactacaacacgtatcagcctcagaaatatcaggacagg
acctggtacgtagccttgaagaagaatggaaaacctaaactgggtccaagaactcacatc
ggacagaaggctgtcttctttctgccccgtcagttggatgactctggagagtga

DBGET integrated database retrieval system