KEGG   Monopterus albus (swamp eel): 109971489
Entry
109971489         CDS       T05607                                 

Gene name
myc
Definition
(RefSeq) myc proto-oncogene protein isoform X1
  KO
K04377  Myc proto-oncogene protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04012  ErbB signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971489 (myc)
   04012 ErbB signaling pathway
    109971489 (myc)
   04310 Wnt signaling pathway
    109971489 (myc)
   04350 TGF-beta signaling pathway
    109971489 (myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109971489 (myc)
   04218 Cellular senescence
    109971489 (myc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109971489 (myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109971489 (myc)
   03019 Messenger RNA biogenesis [BR:malb03019]
    109971489 (myc)
Transcription factors [BR:malb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    109971489 (myc)
Messenger RNA biogenesis [BR:malb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109971489 (myc)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ Herpes_DNAp_acc Pep1_7
Other DBs
NCBI-GeneID: 109971489
NCBI-ProteinID: XP_020475425
LinkDB
Position
Unknown
AA seq 401 aa
MMPLSSSLASKNYDYDYDFLQPYFYYDTEEENFYPQQLQPPAPSEDIWKKFELLPTPPLS
PSRRPSLSSLFPSTADQLEMVTEFLGDDGVNQSIICHADYSQTFLESIIIQDCMWSGFSA
AAKLEKVVSDRLASLHAARKESAAGDSAEDGTWKMNSSYLQDLNTSASECIDPSVVFPYP
VAEGPKQGAGTPPVNIKDLGLDTASSSGCSDSEDDDGDDEEEEVDVVTVEKRQVVKQCDP
SQLETRHPSPLVLKRCHVSTHQHNYAAHPPRREEQPAVKKLKLESGGGAGYSRVLKQISS
NRKCLSPRTSDTEDYDKRKTHNVLERQRRNELKLSFFALRDEIPAVANNEKAAKVVILKK
ATECIYSMKSDEQRLVLLKEQLRMKSELLKQRLSQLQRALA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgatgccgctgagttcaagtttagccagtaaaaactatgactatgactacgattttctt
caaccgtatttctactatgacaccgaggaggagaatttctaccctcaacagcttcagcct
ccggcaccgagtgaagacatctggaagaaatttgaactgctgccgacccctcccctctcc
ccgagccgccgtccgtccctgtcaagcctcttcccctccacagcggatcagctggagatg
gtgaccgagttcctgggcgacgacggggttaaccagagcatcatctgccacgccgactac
tcccagacatttctcgaatcaatcatcatccaggactgcatgtggagtggcttctccgcc
gcggccaagctggagaaggttgtctccgaccggctcgcctccctgcacgccgcgagaaag
gagtctgcggccggcgacagcgcggaggatggaacatggaagatgaacagcagctacctg
caagacctgaacacatccgcctcggagtgcatcgatccatctgtggttttcccttatccg
gtagcagaggggcccaagcagggtgcagggacgccgccagttaacattaaggatttggga
ctggacactgccagcagcagcggctgcagtgactctgaagatgacgatggagatgacgag
gaggaggaggtcgatgtggtcacagtggagaaaaggcaggttgtgaagcagtgtgacccc
agccaactggagacaagacatcccagcccgctagtgctgaagaggtgccacgtctccacc
caccagcataattatgccgcccatccacccaggagagaggagcagccagctgtcaagaag
ctaaaactggagagcggaggtggtgctggctacagcagggtcctcaaacagattagcagc
aaccgcaagtgtttaagtccccggacgtctgatacagaggactacgacaagagaaagact
cataacgtgctggagcgccagaggaggaatgagctgaagctcagcttctttgccctgcgg
gacgagatccccgcagtggccaacaacgagaaagcagccaaagtggtgatcctgaagaag
gctacagagtgcatttacagcatgaagtcagacgaacagagactcgtcttgctgaaagag
cagctgaggatgaaaagtgaacttctaaagcagagactctcacaactgcagcgcgctctc
gcttaa

KEGG   Monopterus albus (swamp eel): 109973991
Entry
109973991         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcriptional regulator Myc-B-like
  KO
K04377  Myc proto-oncogene protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04012  ErbB signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109973991
   04012 ErbB signaling pathway
    109973991
   04310 Wnt signaling pathway
    109973991
   04350 TGF-beta signaling pathway
    109973991
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109973991
   04218 Cellular senescence
    109973991
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109973991
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109973991
   03019 Messenger RNA biogenesis [BR:malb03019]
    109973991
Transcription factors [BR:malb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    109973991
Messenger RNA biogenesis [BR:malb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109973991
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 109973991
NCBI-ProteinID: XP_020479592
LinkDB
Position
Unknown
AA seq 370 aa
MPPVLNYDYDYDTVQPYFFLDGEEDFYPPPCSQILPGPGEDIWKKFELLPTPPLSPSRRP
SLSDIPLLGANHLGAVSELLDERCNTSAAFLQSFIIQDCMWSSSFAAATKLEKVVSERLA
SLQARRDSSTTSSSTGGTRPEENIGYLQDLNAAVTDCVDPSVVFPYSVLSEKREXEMEVG
SEMCLDSPPLSSTDSDSEEEEEGEEEEIDVVAVDSQRASRRSHTSSLVLKRSHINIHQHN
YAAQQPSATPEQPAVKRIKSELSCVVLRMGSSRKSWSPRSDSEDSDKRRTHNVLERQRRN
ELKRSFLSLRDEIPALANNNKAAKVVILKEATEFIMEVREDERRLLKVKDELRRRSRELR
HRLEQLRTSH
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgccgccggttttaaactatgattatgactatgacacggtccagccctacttcttcctg
gatggtgaggaggacttctaccctcctccatgcagccaaatcctcccaggccccggcgag
gacatctggaagaagtttgagctgttgccaacgccccctctgtccccgagccgaaggcca
tccctgtccgacatcccactgcttggcgccaaccacctgggggcggtgtccgagctgcta
gacgagcgctgcaacacctctgctgccttcctccagtccttcatcatccaggactgcatg
tggagcagcagcttcgctgccgccaccaagctggaaaaagtggtgtctgagaggctggcg
tcgctgcaggcccgccgggactcctccaccaccagcagcagcacaggcggaaccaggcct
gaggagaacatagggtacctacaggacctgaacgctgcagtgacagactgcgttgacccc
tccgtggtgtttccgtacagcgtgctgagtgagaagagggagncagagatggaggtgggg
tcggagatgtgtctggactcaccgccactcagcagcacagacagtgactcagaagaagaa
gaagagggggaggaagaggagattgacgtggtggcggtggacagtcagagggcgtctcgg
cggtcgcacacctcctcgctggtcctgaaacgctctcacatcaacatccaccaacacaac
tatgccgcccagcagccctcggcgacacctgagcagcctgctgtgaagcgtattaagtca
gagctgagttgtgtggtgctgaggatgggcagcagccgcaagagttggagtccacggtcg
gacagcgaggacagcgacaaacgtaggactcacaatgtgctggagaggcagcggcggaac
gagctgaagaggagcttcttgtctctaagggatgaaatcccagcgctggccaacaacaac
aaagcggccaaggtggtgatcctgaaggaggcaacggagttcatcatggaggtcagagag
gatgagcggaggctgctgaaggtgaaggatgagctgaggaggaggagccgagagctgagg
cacagactggagcagctcaggacttcacattaa

KEGG   Monopterus albus (swamp eel): 109974776
Entry
109974776         CDS       T05607                                 

Definition
(RefSeq) transcriptional regulator Myc-2-like
  KO
K04377  Myc proto-oncogene protein
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04012  ErbB signaling pathway
malb04110  Cell cycle
malb04218  Cellular senescence
malb04310  Wnt signaling pathway
malb04350  TGF-beta signaling pathway
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109974776
   04012 ErbB signaling pathway
    109974776
   04310 Wnt signaling pathway
    109974776
   04350 TGF-beta signaling pathway
    109974776
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109974776
   04218 Cellular senescence
    109974776
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109974776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:malb03000]
    109974776
   03019 Messenger RNA biogenesis [BR:malb03019]
    109974776
Transcription factors [BR:malb03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    109974776
Messenger RNA biogenesis [BR:malb03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109974776
SSDB
Motif
Pfam: HLH Myc_N Myc-LZ Macoilin Nucleo_P87
Other DBs
NCBI-GeneID: 109974776
NCBI-ProteinID: XP_020480812
LinkDB
Position
Unknown
AA seq 383 aa
MLQSFAQAQDWLYTEPLLFDDEFCQSLMKDLQSLPTPPHSPPLKTGLGGSKPLSKEDQLS
YVSDILLEDHDMQFNWNCDFFHSDDAEKDGGPSQPCSPLEEGGEDCLWQCLAVDRSLEEK
LVSTVLGSSPLLSDIDTSIFEEIAGSTLDCQNLMDTQEPSESTSGYGSTGGELSAYSSSD
SEEEIDVVTVVRCPSSSSSLPSLADLSVRQQKQEEEQRERALQLHFEIQLQHNYAAPCPA
SPPPSSSSNKRSRGNDSSSRFHHSSRSSSSSSSSSSSLSSSSRYHHHHSYRNSTETEDEE
ERRRTHNVMERQRRNELKNCFMRLRDNVPELSHNDKASKVVILKKARDCIYDLEDKCHRL
QAKRDKLRARQEELKARLEQFHS
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgttgcaaagcttcgctcaggcgcaagattggctttacacggagccgctgctctttgat
gatgaattctgccagagtttgatgaaggacctccagtccttgccgacaccgccgcactcc
cccccattgaagactgggctgggtgggagtaaacctctgtccaaggaagaccagctgagc
tatgtgtcggacatcctgctggaggaccatgacatgcagttcaactggaactgtgacttc
tttcactctgatgatgctgagaaggacggcgggcccagccagccctgctcccctctggag
gagggtggcgaggactgtctgtggcagtgcctggcagtagacaggagcctggaggagaag
ctggtctccacggtgctgggttccagcccgctgctgtctgacattgacaccagcatcttt
gaggagatcgctggctccacgctggattgccagaacctgatggacactcaggaacccagt
gaatccacatcaggctacggatccactgggggcgagctgtccgcctattcatccagtgac
tctgaggaggagattgatgtcgtgacggtggtgcggtgtccctccagctcctcctccctg
ccctcattagctgacctgtctgtccgtcagcagaagcaggaagaggagcagcgggagcgg
gctctccagcttcactttgagatccagctgcaacacaactatgccgcaccctgccccgcc
tcccccccaccttcctcctcatccaacaaacgttcgagaggaaacgacagctcatcacgc
ttccaccactcgtctcgtagctcttcttcttcatcatcatcatcatcatcattgtcgtca
tcgtcgaggtaccaccaccaccactcgtaccggaactcaacagaaacagaggatgaggag
gagcggcggcggactcacaacgtgatggagcgccagcgacggaatgagctgaagaactgc
ttcatgcgcctgcgtgacaacgtgccggagttgtcgcacaatgacaaggcatctaaggta
gtgatcctgaagaaggccagagactgcatctacgacctggaggacaagtgccacagactg
caagccaagagggacaaacttcgagccagacaggaagagctgaaagccagactggagcag
ttccacagctaa

DBGET integrated database retrieval system