KEGG   Monopterus albus (swamp eel): 109971785Help
Entry
109971785         CDS       T05607                                 

Gene name
acaa1
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00071  Fatty acid degradation
malb00280  Valine, leucine and isoleucine degradation
malb00592  alpha-Linolenic acid metabolism
malb01040  Biosynthesis of unsaturated fatty acids
malb01100  Metabolic pathways
malb01212  Fatty acid metabolism
malb03320  PPAR signaling pathway
malb04146  Peroxisome
Module
malb_M00087  beta-Oxidation
malb_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109971785 (acaa1)
   00592 alpha-Linolenic acid metabolism
    109971785 (acaa1)
   01040 Biosynthesis of unsaturated fatty acids
    109971785 (acaa1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109971785 (acaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109971785 (acaa1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    109971785 (acaa1)
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     109971785 (acaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt SPDY
Motif
Other DBs
NCBI-GeneID: 109971785
NCBI-ProteinID: XP_020475915
LinkDB All DBs
Position
Unknown
AA seq 426 aa AA seqDB search
MYRLRIISGHLAPSGSSNYTRDLSRTDCGSAGSRSPDDVVVVHGRRTAIGKAKRGSFKDT
TPDELLSAVMTAVLADVGLSPDKLGDVCVGNVLQPGAGAVMARVAHFLSGFPETVPVYAV
NRQCSSSLQALFNIAGAIRSSSIDLGLACGVESMTLRSTDKPGDLSSRLTDHDKARDCLI
PMGILSHHLRERGGGVSREKQDAFALSSHQKAARAQSSGLFDHEILPVTTRFVDDEGKEH
EVTVRKDDGIRPGTTLAGLGKLRPAFKPYGSSTAGNSSQVSDGAAAVLVGRRSVVEALGL
PVLGVLRASAVVGVPPEVMGIGPAVAIPVALEQAGLTVADIDVFEINEAFASQAVYCVEK
LGIPEEKVNPNGGAIALGHPLGCTGARQVVTLLHELRRRGRRAFGVVSMCIGTGMGAAAV
FEYPGP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtacaggttacggatcatttctggacacctggctccgtctgggtcctcgaactacacg
cgggacttatccaggaccgactgcggatccgcggggagccggagtcctgacgacgtggtg
gtggttcacggacggaggaccgctatcgggaaagccaagaggggatcttttaaggacacc
acaccggacgagcttctgagtgcagtgatgacagctgtgctggcagatgttgggctgtca
cctgacaagctgggagacgtgtgtgtgggcaatgtgctgcagcccggcgccggtgctgtg
atggccagagtggctcacttcctcagtgggtttccagagaccgttccggtctacgccgtg
aaccggcagtgctcctctagcttgcaggcgctcttcaacatcgcaggagccatcaggagc
agctccattgacctgggcctggcgtgtggcgtggagagcatgacgctgcgatctacggat
aaaccaggggacctgagctccaggctgacagaccatgacaaggccagagactgcctgatc
cccatgggtatattatcacatcacctccgagagcggggggggggggtctctagagaaaag
caggacgccttcgctctcagttctcatcaaaaagcagcgcgggcacagagcagcggactg
ttcgaccacgagatccttcccgtcaccaccaggtttgttgacgacgagggcaaagagcac
gaggtgacggtcaggaaagatgatgggatccgaccagggacaacgctggcaggacttggt
aaactgcggccggccttcaaaccttacggcagctcaacagcaggtaactccagccaggtg
agcgacggagcagcggccgtgctggttggtcgcaggtctgtggtggaggctctgggtctg
ccggtgctgggagtcctgagggccagtgcagtggtgggggtccctcctgaggttatggga
attggaccagcggtcgccatccctgtggctctggaacaagctggactgacagtggccgat
atcgacgtgtttgaaatcaacgaggcctttgccagtcaggctgtgtactgtgtggagaag
ctgggcatcccagaggagaaggtgaatccgaatggaggagccatcgctctgggtcatccc
ctgggctgcaccggcgcccgacaggtggtgacgctgctccacgagctcagacgcagaggc
cggagggcgtttggtgtcgtgtccatgtgcatcgggactgggatgggcgccgctgctgtc
tttgaataccccggaccatag

DBGET integrated database retrieval system