KEGG   Monopterus albus (swamp eel): 109971919
Entry
109971919         CDS       T05607                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109971919 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:malb04052]
    109971919 (epo)
Cytokines and growth factors [BR:malb04052]
 Cytokines
  CSF and other factors
   109971919 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 109971919
NCBI-ProteinID: XP_020476140
LinkDB
Position
Unknown
AA seq 204 aa
MGNRRTYEPNHEDPVRGYADTAMEFPRLLALLLIVLEWTRPGLPSPLRPICDLRVLNHFI
KEARDAEVAMKSCREGCSLSEPVTVPQTRVDFDVWEKKNALEQAQDVQSGLWLLQQAFGF
FQTSVTNAALHSHIDNSIRNLFSISAVLRSLNIQEYTPSASAAELEGTWRVSSATDLLQV
HVNFLRGKVRLLLLDAQACQQDLS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggcaatagacggacctatgagccaaaccacgaggaccctgtgaggggctatgcggac
accgctatggagtttcctagactgcttgccttgctgttgatagtcttggagtggacccgg
ccaggcctaccatccccgctgaggccgatctgtgacctgagggtcctgaaccatttcatt
aaggaagcacgagacgcagaagtcgctatgaaatcatgtagagaaggatgcagcctgtca
gagcctgtcactgttccacaaaccagagttgactttgatgtctgggagaagaaaaatgct
ttggagcaagctcaggacgtgcagtctggcttatggcttttacaacaggccttcggcttt
ttccagacctcggtcaccaatgcagcgctacacagtcacatcgataattccatcagaaac
ctgttcagcatcagtgctgtgctacgcagcctcaacatccaggaatataccccatcagca
agtgcagcagagcttgagggaacatggagggtgtcctcagctacagatttgcttcaagtc
catgtcaactttctgcgaggaaaagtgcgcctcctcctgttggatgcacaggcttgtcag
caagatctcagctga

DBGET integrated database retrieval system