KEGG   Monopterus albus (swamp eel): 109971941
Entry
109971941         CDS       T05607                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04144  Endocytosis
malb04218  Cellular senescence
malb04350  TGF-beta signaling pathway
malb04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109971941
   04350 TGF-beta signaling pathway
    109971941
   04068 FoxO signaling pathway
    109971941
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109971941
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109971941
  09143 Cell growth and death
   04218 Cellular senescence
    109971941
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109971941
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109971941
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109971941
Protein kinases [BR:malb01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   109971941
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase TBCC
Other DBs
NCBI-GeneID: 109971941
NCBI-ProteinID: XP_020476172
LinkDB
Position
Unknown
AA seq 629 aa
MARCGAVWPATLVLLTAGLPLVVQSLSHLNFNLCKWCEMSSPTCKDSVCISNCSLSSFCT
VTEEICVAIWRKTNNTMMVHTMCHHPSEPLEGVDPGLLLNFTSRECHMVPQPAEDGAMMV
CGCRGDHECNDKLIFNKGANGYSKVQSKDMIPVVVVSLVPPVLVATVAIAAFYFYRTHSP
DKPGPPARSDWTTKCAPKLYQALDLPGGGLGAQGEGGGGGVTGPGSERDGYNVKRPSLDN
NIISDITDCLGQMAELLPIKLEVLVGKGRFAEVWRASLLQGQKGGDNSYETVAVKVFPAV
EYASWRNECSIFSDPSLEHENVVRFLAAEQRGPPSQALINYWLVLDYHSLGNLQDFLTAN
ILSWQDLVAMAGSIARGLAHLHSDTTARGVPKVPVAHRDLKSSNIVVKSQTECALCDFGL
ALRLDLSLTVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASR
CHAIGEVRSYEPAFGSQVCEQPCVDSMRDLVLRDRGRPEIPSVWTQHQGMSVFCSTITEC
WDHDPEARLTTHCVVERFNALQRDEEEELRPDTDREEDEQRDKDSPDQSHSFSTAASSPS
SSASIEVPQPVRDGTEVSHDSLVYTGSVV
NT seq 1890 nt   +upstreamnt  +downstreamnt
atggctcgatgcggggcggtttggcccgcgaccctcgtcctgctgacggccggtcttccc
cttgttgtccagtctctcagccacctgaacttcaacctgtgtaagtggtgtgagatgtcc
agcccgacgtgtaaggacagcgtctgcatcagtaactgctccctgtcgtccttttgcact
gtcactgaggaaatctgtgttgccatatggaggaagaccaacaacaccatgatggtgcac
accatgtgtcaccaccccagtgagcctctagagggcgtagacccaggcctgttgctgaac
ttcacctccagagagtgtcatatggtccctcagccagcagaggacggagccatgatggtc
tgtggctgccggggagaccatgagtgcaacgacaaactgatcttcaacaagggagcaaac
ggttactccaaggtgcagagtaaggacatgatcccagtggtggtggtgagtttggtgcct
cctgtcctggtggccacagttgccatcgctgccttctacttctaccgcacccacagccct
gataaaccgggccctcctgcacgctctgactggaccaccaaatgtgccccaaagctctac
caggctttggacctgccaggtggggggttgggggctcagggggagggtggaggaggaggt
gtgacaggtcctggatctgaaagggatggatataatgtcaagaggccatctcttgacaac
aacatcatcagtgacatcacagactgcttgggccaaatggctgaactactgcctatcaaa
ctggaagtactggtggggaaggggcgcttcgctgaggtgtggagggcatccctgctacag
ggacagaagggtggagataacagttatgaaacagtggcagtgaaagtctttccagctgta
gagtatgcctcatggagaaacgagtgctccatcttctcggacccctcactagagcatgaa
aatgttgttcgattcctggcagctgaacagaggggtccacctagtcaggcactcataaat
tactggctggttctggactaccacagccttggaaacctgcaggacttcctcactgcaaac
atactgagctggcaggatcttgttgccatggcaggcagcatcgctagagggctagctcat
ctccacagtgacacaacagccagaggggtaccaaaggtgccagttgcccaccgggaccta
aaaagcagtaacatcgtggtaaagagccagactgagtgtgctctgtgtgactttggtctg
gccttgagactggacctctccctcaccgtggacgactatgccaacagtggacaggtgggg
acagctcgctacatggctcctgaggtgctggagtccagggtgaacctggaggacctcgag
gcctttaaacagatggatgtttactccatggctctggtcctgtgggaaatggcctcccgc
tgccacgccatcggagaggtgaggagctacgagccagcgtttggctcccaggtgtgtgag
cagccctgcgtggacagtatgagagacctggtcctgagggaccgaggacggcccgagatc
ccatcggtgtggacgcagcaccaggggatgagtgtcttctgctccaccatcactgagtgc
tgggatcacgaccctgaggccagactgacgactcactgcgtggtggagcgcttcaacgcc
ctgcagcgggatgaggaggaggaactgaggccagacactgacagagaggaggatgaacag
agagacaaggactcaccagaccagagtcactccttctccactgctgcttcctcgccctcc
tcctctgcctccatcgaggttcctcagccagtgagagacggtacagaggtatcccatgat
tccctggtttacactggctctgtggtgtga

DBGET integrated database retrieval system