KEGG   Monopterus albus (swamp eel): 109972058Help
Entry
109972058         CDS       T05607                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00010  Glycolysis / Gluconeogenesis
malb00053  Ascorbate and aldarate metabolism
malb00071  Fatty acid degradation
malb00280  Valine, leucine and isoleucine degradation
malb00310  Lysine degradation
malb00330  Arginine and proline metabolism
malb00340  Histidine metabolism
malb00380  Tryptophan metabolism
malb00410  beta-Alanine metabolism
malb00561  Glycerolipid metabolism
malb00620  Pyruvate metabolism
malb01100  Metabolic pathways
Module
malb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109972058 (aldh2)
   00053 Ascorbate and aldarate metabolism
    109972058 (aldh2)
   00620 Pyruvate metabolism
    109972058 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109972058 (aldh2)
   00561 Glycerolipid metabolism
    109972058 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109972058 (aldh2)
   00310 Lysine degradation
    109972058 (aldh2)
   00330 Arginine and proline metabolism
    109972058 (aldh2)
   00340 Histidine metabolism
    109972058 (aldh2)
   00380 Tryptophan metabolism
    109972058 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109972058 (aldh2)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109972058 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109972058
NCBI-ProteinID: XP_020476323
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MLRTVFYRALPRLGRLSACQYSGIAIPAPNTQPEVHYNKLMLSNEWQDAASGKPSPTINP
ATGEVICQVAEADETDVNRAVKAAHNAFRLGSPWRRMDASHRGLLLSRLADAIERDAAYL
AELETLDNGKPYTISYSVDVPHVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPIGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVANLIKEVGFPEGVVNILP
GMGPSAGAAIARHMDIDKVAFTGSTEVGHLIQQASGSSNLKKVTLELGGKSPNIILSDAN
MEDAVEQSHFALFFNQGQCCCAGSRTYVQAEIYDEFVERSVERAKKRVVGSPFDFKTEQG
PQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDDMTIAREEIFG
PVMQILKFKTLEEVVTRANNTKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFGAQ
APFGGYKASGNGRELGEYGLDNYTEVKTVTIKVPQKNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtacagtgttttatcgggcccttcccagattaggcagactgtcggcgtgtcag
tactctggtattgccatcccagcacccaacactcaacccgaggtccactataataagtta
atgctttcaaatgaatggcaggatgcagcaagtggaaaaccttcccctaccatcaaccca
gcaaccggtgaagtaatctgtcaagttgcagaggctgacgagacagatgtaaacagggca
gtgaaagcagcacataatgccttcagattggggtcaccgtggcgacggatggatgcctct
catcgtggcctgctactcagccgactggctgatgccattgagagggatgctgcctatctc
gctgaactagagacccttgacaatgggaagccatatacaatttcttattccgtggatgtg
cctcatgtggtgaaatgtctcaggtactatgcaggctgggctgacaaatgggagggaaag
accatccccattgatggagattatttctgctacaccaggcatgaacccatcggagtttgt
ggacagatcataccgtggaacttccctctgttgatgcaggcctggaaacttggccctgcc
cttgcaactggtaacacagtggtgatgaaagttgcagaacagacaccgctgacagcactt
tatgtggctaacttgattaaagaggtgggttttcctgaaggtgttgtgaatatcttgcct
ggcatggggccatcagctggtgctgccattgcaagacacatggatattgacaaggtggcc
ttcactggatccacagaggttggtcatctaatccagcaggcttcaggtagcagtaacctg
aagaaagtcactctggagctaggaggaaagagtcctaatatcatcctttctgacgccaac
atggaagatgcagtggagcagtcccactttgctctgtttttcaaccaaggccagtgttgc
tgtgctggttcacgaacttatgtccaagcagaaatctatgatgaatttgtggagcggagt
gttgagcgagctaagaaacgagtggtgggaagcccttttgacttcaagaccgagcaggga
ccacaggtagatcaggagcagttcaacaagattttgggttacatcagcagtggaaagaga
gagggagcaaaactcatgtgcggaggaggagtggctgcagacagaggatactttatccaa
cctacagtgtttggagatgttcaggacgacatgacgattgccagggaggagatctttggt
ccagtgatgcagattttgaagtttaaaacactggaggaagttgtaacaagagccaacaat
actaaatatggtctagcagccgctgtgtttacgaaggatattgataaggctaactatgtc
tccagtgggctccgtgctggcacagtctggattaactgttatgatgtgtttggggctcag
gcaccatttggcggttacaaggcttcaggcaatggcagagagctaggagagtatggtctg
gacaactacacagaagtcaaaacggtgaccattaaggtaccacagaagaattcgtag

DBGET integrated database retrieval system