KEGG   Monopterus albus (swamp eel): 109972147
Entry
109972147         CDS       T05607                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
malb04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109972147
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109972147
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:malb04030]
    109972147
G protein-coupled receptors [BR:malb04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109972147
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 109972147
NCBI-ProteinID: XP_020476474
LinkDB
Position
Unknown
AA seq 305 aa
MANTSGKCYCNETIKFFYEASGKKINDNWETRDYVIVALGMMVCFIVIFSNLLVIGAILK
NRRFHFPIYYLLGNLGLADLFAGVAYLHLMFHTGPWTIKLSKEQWYVRQGLIDTSLTASV
LNLLAIAVERHQTIFKMQLHSKMSTRRVFIIMLFIWVVAIFMGLIPTMGWNCLCNLKNCS
TMAPLYSRSYLVFWAVLNLVTFSLMVAVYTRIFVYVRHKSKQMSQHTSQIRHRETVLNLM
KTVSMILGWDTDMRRTFKEILCYPCQQGKTDRGNSGMQFNTLEREVLSESNGGDDRSHKQ
NSHSH
NT seq 918 nt   +upstreamnt  +downstreamnt
atggccaacacctctgggaaatgctactgcaatgaaaccatcaaatttttctacgaagca
agtggcaaaaagatcaatgacaactgggaaacccgagattatgtgatcgtagctctgggc
atgatggtctgcttcattgtcatcttttccaaccttttggtcataggggccattttaaaa
aaccgacgctttcactttcccatctactacttgctgggcaatctgggtttggcagacctc
ttcgcaggcgtcgcctacctccacctgatgtttcatactggtccctggacaattaagctg
tctaaggagcagtggtatgtgcggcaggggctgatcgacaccagcctgacagcctcagtc
ctcaacctcctggctattgctgttgagcgtcaccaaaccatcttcaaaatgcagctgcac
agcaagatgagcacccggcgtgttttcatcatcatgctgttcatctgggtggtggcaatc
ttcatgggcctgattcccaccatgggctggaattgcctgtgtaacctgaagaactgctcc
accatggcgccgctgtacagccgcagctacctggtgttctgggctgttctcaacctggtg
accttctccctcatggtcgcagtctacacccggatctttgtctacgtgaggcacaagagc
aagcagatgtcacagcacaccagccagatcagacacagagagacggtgttgaacctgatg
aagaccgtctccatgatcctgggttgggacactgacatgaggaggaccttcaaggagatc
ctgtgctacccgtgccagcaaggcaaaaccgacaggggcaactctggaatgcagtttaac
accctggagcgcgaggtactgtccgaaagcaatggaggtgacgaccgcagtcacaaacaa
aacagccactcgcactaa

DBGET integrated database retrieval system