KEGG   Monopterus albus (swamp eel): 109972861
Entry
109972861         CDS       T05607                                 

Gene name
ei24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109972861 (ei24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 109972861
NCBI-ProteinID: XP_020477717
LinkDB
Position
Unknown
AA seq 340 aa
MTDSVRAFLCNVATGIKDSILGIGTISKLDARIQQKREEQRRRRASGALAQRRAQSEERK
PDNEPKVASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQSLTAKIIGDPSLHGNVWSWLEF
ILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGCKAQPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNNGIEMHQRLSNIERNWP
YYFGFGLPMALLTALPSSYIISGCLFSILFPLFIISANEARTPTKLYHFQLRLFSLVVLI
SNKLFHKTVYLQSSLTSSISSERLSTPHTSPTRQRILPTQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgacagacagcgtcagggccttcctctgcaatgttgcgacggggatcaaggactccata
ttggggatcggaacaatctccaagctggatgctcgcattcagcagaaaagagaagagcag
cggaggagaagggccagtggggccctggcacagagaagggcacagagtgaggagcgcaaa
ccggacaatgaacccaaagtagccagcaggatttttcagtgttgtgcctggaatggggga
gtgttctggctcagtctctttctcttctaccgggtgtttatcccactgctgcagagtctc
acagcaaaaattattggtgacccctccctacatggcaatgtgtggtcctggttagagttc
atcctgacctccgtcttcagtgctctctgggttctccctctgtttgtcctcagcaagata
gtcaatgccatctggttccaggatatcgctgacctagcatttgaagtgtctggctgtaaa
gctcagccattccccagtgtcagtaagatcatcgcagatatgctttttaacctcctcctc
caggcactcttcctcattcagggtatgatcgttagcctcttccccatcgacgccattgga
cagatggtgagcctcctccacatgtctctgctctattccctgtactgctttgagtatcgc
tggttcaacaatggcattgagatgcaccaacggctttccaatattgagaggaactggccc
tattactttggctttggtttacccatggcgctgctcactgccctgccctcctcatacata
atcagtggctgcttgttctccatcctcttccctctgttcatcatcagcgctaatgaggcc
aggacgccaacaaagctgtaccacttccagctgcgtctcttctcccttgttgtgctgatc
agtaacaagcttttccacaagacggtctacctgcagtcctcgctgacgtcatccatctcc
tcagagaggctgtccacgcctcacacctccccgacccgtcagagaattctgcccacccag
tga

KEGG   Monopterus albus (swamp eel): 109973370
Entry
109973370         CDS       T05607                                 

Gene name
tp53i3
Definition
(RefSeq) quinone oxidoreductase PIG3 isoform X1
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109973370 (tp53i3)
Enzymes [BR:malb01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     109973370 (tp53i3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N
Other DBs
NCBI-GeneID: 109973370
NCBI-ProteinID: XP_020478551
LinkDB
Position
Unknown
AA seq 415 aa
MGGYPLCIGLETMVTPNFAKAANVRNDARALSSLQQLPTRSCHCYNYQMNHILHAGRFLL
GNPHQTTWHKCCSSLAKMMQAVYVDMPGGPESLLLRNIPRPQPRNGQVLIKVHATALNRA
DLLQRRGLYPPPPGESDIIGLEVAGTVDTLGLGVKSSWKPDDRVMALLCGGGYAEYVAVP
EELLMPVPPNLTFCQAAAVPEAWLTAFQLLVLVAQVKEGEVVLVHAGASGVGTAAVQLVR
LFGAVPIITAGSPEKLKMAEELGAAAGFNYKEESFAQGVCDFTGGKGANIILDCIGGRNW
EQNVSCLATDGRWVLYGTLGGRTVEGDLFGRLLSKRGHLLSSLLRSRNLQYKADLVKAFS
HRVLPYFSGQAASLRPVIDSTFTLGDIAEAHRHMEANKNTGKIVINVIPQNQETH
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggtggttatccgctttgcatcggcttggaaacaatggtaacgccaaactttgctaaa
gccgcgaacgtaaggaatgacgctcgcgcgttgtcatcacttcagcaattaccaactagg
agctgtcactgctacaactatcaaatgaatcacatcctacacgctggaagatttttactg
ggaaaccctcaccagacaacctggcacaagtgttgctctagcttggccaagatgatgcag
gcagtgtatgtcgacatgccaggaggaccggagagtttgctgctgcgaaatatccccaga
cctcaacctagaaatggacaggttctgattaaagttcatgcaactgccctcaacagggcg
gacttattacagagacgaggactgtacccacctcccccaggtgagagtgacatcataggc
ctggaggtggctggcactgtggatactctgggcctgggggttaaaagcagctggaagcca
gatgacagggtcatggccttgctctgtggaggaggatatgcagaatacgttgctgtgcct
gaggagcttctcatgcctgttccccctaatctcacattctgccaagctgctgcagtccca
gaggcctggctcactgctttccagctgctggttttagtagctcaggtgaaggagggcgag
gtggtgctggttcatgctggagccagcggcgtaggaacagccgctgttcagctggttcgt
ctgtttggtgccgtgcccatcattaccgcggggagcccagaaaaacttaagatggctgag
gaactgggagcagcagctggttttaactacaaagaggaaagcttcgcacagggagtctgt
gactttacaggaggcaaaggggcaaacattatccttgactgcattggtgggcgaaactgg
gagcagaatgtgagctgcttagccacggatggcaggtgggtgctgtacggcacattgggt
ggcaggacagtggagggagatctgtttggcagacttctctctaagcgaggacacctgctc
agcagcctcctccgctctcgtaatcttcagtacaaagcagacctggtgaaggctttttca
cacagagtgttaccatatttctcaggccaggccgcctccttgaggccagtgattgacagc
acattcaccctgggagacattgcagaggctcatcggcacatggaagccaacaaaaacacg
gggaagattgttattaatgtgattccacagaatcaagaaactcactga

DBGET integrated database retrieval system