KEGG   Monopterus albus (swamp eel): 109973963
Entry
109973963         CDS       T05607                                 

Gene name
adgrb1
Definition
(RefSeq) brain-specific angiogenesis inhibitor 1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109973963 (adgrb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109973963 (adgrb1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109973963 (adgrb1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:malb04030]
    109973963 (adgrb1)
Peptidases and inhibitors [BR:malb01002]
 Mixed peptidases
  Family P2
   109973963 (adgrb1)
Membrane trafficking [BR:malb04131]
 Endocytosis
  Phagocytosis
   Others
    109973963 (adgrb1)
G protein-coupled receptors [BR:malb04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   109973963 (adgrb1)
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin GPS TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 109973963
NCBI-ProteinID: XP_020479541
LinkDB
Position
Unknown
AA seq 1661 aa
MTSIVYQIPMPGQSRWPLPVLLLYFAPVLLMESRCHAAPSGPESDSCSTLVQSRFFGFFL
SSSVFPTVPCSWTLQNPDPRRYTIFIKVTKPTDDCVPSQLHTFQYDSFLETTHTYLGMES
FDEVVSLCDTSAPVAFLEAGKQFLQMRKGPPRVGKAVTNSDGDFKTEYLVVGKRNPSMAA
CQMLCQWLEDCLASSTSNRPCGIMQTPCLCWDPPPQLSEGDSCYLNGVYLENCLSSVKES
GKDAELNGGWSVWGQWAHCSSECGGGIQTRTRSCQSPPEESYMCEGVVEEGRPCNTQPCT
GKGRHLSRSQSLRSVDSRKRDDVDKPRSGQQNAQTVDSAAGEEWSAWSVCSATCGEGWQS
RTRFCVSSSYSTQCSGPLREQRPCNNSAVCPVHGAWEEWSPWSLCSSTCGRGYRSRTRSC
NPPQFGGDPCVGPEKQTKFCNIALCPADGVWNEWSSWSSCSASCSNGTMQRTRECNGPSF
GGSECKGEWLETVDCFLGECPVDGKWQPWSLWSGCSKTCGGGSQQRNRICYGPFFGGQPC
PRERQEVQHCNEKKCPEPHEICGEDNFSNVVWKMTPAGDTAAVRCPPNAMGLILRRCTLD
EEGIAYWENPTYMKCISSDYRSIQTLTREHLSKAQRGLVGDGVSEVMTKLRVTSSDGTSY
SGDLLAIMDVLKNMTEIFRRAYYSPSSADMRNFMQSVSNLLMEENRERWEEAQLLGPSIK
ELFRLVEDFVDVIGLRMKDFQDMYEVTDNLVLSIHKRPVVGHADISFPMKGWRGMVDWAR
SSEDRVTIPKNILSTGKPDSDDTSTFVTGIALYRNLGSILTLQRNSTVLNSKVLSVTIKP
TPASLSAPVVVEFSHMYNGTTNQTCVSWDESDSSSLLGSWSARGCKAVLVDSFRTKCVCD
RLSTFAILARLNPEMNMDKTQLPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVIL
INFCLSIISSNALILIGQTQTRNKILCTLIAAFLHFFFLSSFCWVLTEAWQSYMAVTGRL
RNRIIRKRFLCLGWGLPALVVAISVGFTKAKGYGTPSYCWLSLEGGLLYAFVGPAAAVVL
VNMVIGILVFNKLVSKDGITDMKLKERAGAFQSGTHQSQRPPPMSSMIGASLWSSCVVLP
LLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQEAVKCRVVDRQE
DTNGDSGGSFQNGHAQLMTDFEKDVDMACRSGTVKRSSLQGEEMSSSGALTLQKGSNFNT
MPASMAKVHLQNVADYTSHTLTLRREKGATKGISTELPGAKSIYICEGELFKQLDGELPR
VNGEGSSEGAGKGPGYLILPTNNTGTLKPAKGKEEQTAKYIEQLPQTRLIHLANPASGQP
VPGFGLNTLPADQVSVSCSDRDSPAHNLQTMPRDSQVANMCDGGDSGNSGVMSKSETVST
LSTSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLSRKIHSADKDRESPPVDAKAAKRWS
VSSASSDKTNMSDKLQTPSKRAWDGIRKTHSPPSWVWRQWQPLLWSCTQWNDTTVIGLIS
EGDETTYREEVGVLWLQAVKEEEQDADDQQQLQSSTLHFTQAVTILLPNELFKWHQLICV
CINLYYMVPPDVALIHCYAAPALGAREHKDGTSRARHFNHG
NT seq 4986 nt   +upstreamnt  +downstreamnt
atgacaagcattgtttatcagattcctatgcctggccagtcaaggtggcctctcccagtg
ctcctcttgtattttgcccctgtattgctaatggagagccggtgtcatgcagccccctcg
ggaccggagtctgactcctgctccaccttagtccagagccgcttctttggcttcttcctg
tcatcatcagtgttccccacagtgccttgttcctggaccctccagaaccctgatccacgc
cgctacaccatctttattaaggtgaccaaacctacagatgactgcgtgccatcacagcta
cacactttccaatatgactccttcctagaaactacacacacctacctgggcatggagagc
tttgatgaggtggtgagtttgtgtgacacctctgccccagtggccttcctggaggctgga
aagcagttcctccaaatgaggaaaggacctcctcgggtgggcaaagctgtcacaaacagt
gatggggatttcaaaacagagtacctggtggtggggaaacgcaaccccagtatggcggcc
tgtcagatgctctgccagtggctggaggattgtttggcctccagcacatctaacaggccc
tgcggtattatgcagactccatgtttgtgctgggacccaccaccgcaactcagtgaggga
gacagctgttatctcaatggagtttacctggaaaactgtttatccagtgtgaaagagagt
ggaaaagatgcagagctaaatggtggctggagtgtgtggggtcagtgggcacattgcagc
agcgagtgcggcggtgggattcaaacgcgaactaggagctgccagtcaccacctgaggag
tcgtacatgtgtgagggtgtagtggaggagggacgaccctgcaacacacagccctgcacc
ggcaaaggtcgccatctctctcgcagccaatcgcttcgctcggtggacagtcgcaagcgt
gatgatgtagacaagccccgcagcggacagcagaatgctcagacagtagactcagctgca
ggtgaggagtggtcagcatggagtgtgtgttctgccacatgtggggagggctggcagagt
cgcactcgtttctgtgtgtcctcctcctacagcacccagtgtagcgggccactgcgagag
cagagaccttgcaacaactctgctgtttgtccagtgcatggtgcttgggaggagtggtca
ccctggagtttgtgttcatcaacttgtggccgaggttacaggtcccgaacacgaagctgc
aatcccccccagtttgggggagatccctgtgttggcccagagaaacagacaaaattctgc
aacatagctctctgtccagcggatggagtgtggaatgaatggtccagctggagctcctgt
tctgcctcctgctctaatgggaccatgcagagaaccagagagtgcaatggcccttctttt
ggaggctctgagtgcaaaggagagtggttggagactgttgactgcttccttggagagtgt
ccagtggatggcaagtggcagccatggtccttgtggtcgggctgttctaaaacctgtgga
ggtggaagccagcagagaaacaggatttgttatgggcccttttttggggggcagccttgt
cctagagaacgacaggaggttcaacactgtaatgaaaagaaatgtccagaacctcatgaa
atatgtggtgaggacaacttctctaacgttgtatggaagatgactccagcaggggacaca
gcagccgtacgctgtcctcccaatgccatggggctaatcttgcgccgctgcaccctggat
gaagagggtattgcttactgggagaaccccacttatatgaaatgcatttccagtgactat
cgcagcatacagactttgactcgggagcatttgtccaaagcacagcgtggccttgtggga
gatggcgtttctgaggtgatgaccaagctgagagttacatccagtgatgggaccagctac
agtggtgatctgctagccatcatggacgtgctgaagaacatgacagagatcttcaggagg
gcatactacagccccagcagtgcagacatgaggaacttcatgcagtcagtcagcaatctg
ttgatggaagagaacagggagagatgggaggaagcacaactgctagggccaagtatcaaa
gagctgtttcgtcttgtggaggactttgtggatgtcattggcctgaggatgaaagacttt
caagacatgtatgaagtcaccgataacctagttttgagcatccataagcgtccagtggtg
ggtcatgcagacatcagcttccccatgaaaggctggaggggcatggtggactgggcccgt
agctctgaggacagagtcaccatccccaaaaatatcctgtccactggcaagccagattca
gacgacacctcgacgtttgtaactggcattgctctgtacagaaacctgggcagcattctg
actctgcagaggaatagcacagtcctcaactccaaggttttgtcagtgactatcaagccc
acccctgcttccctctctgctcccgttgtagttgaattctctcacatgtacaacggtacc
accaaccagacctgtgtatcttgggatgagagcgacagctcctctctgctgggatcctgg
tctgccaggggctgcaaagccgtgctagtcgactcattcagaaccaaatgcgtgtgtgac
agactgtccaccttcgccattttagcacggctaaatcccgaaatgaacatggataagaca
cagctcccgtctgtgacactgattgtgggctgtggagtgtcttcactgacactgttgctg
ctcatcatcatctatgtgtctgtctggaggtacattcggtctgagcgctcagtcatcctc
atcaacttctgcctttccatcatctcctccaatgcccttattctgattgggcagactcag
acacggaataaaatcttgtgcaccctgattgctgcgttccttcatttcttcttcctatcc
tcattctgctgggttctgacagaggcgtggcagtcatacatggctgtgacgggacgcctc
aggaatcggattatacgcaagcgcttcctgtgtcttggctggggtctccctgcattagtt
gtggctatctcagtgggattcactaaggcaaagggatatggaacaccaagctactgctgg
ctatctctggaaggagggcttctttatgcatttgttggacctgctgccgctgttgtcttg
gtaaacatggttattgggattctcgtttttaacaaactggtgtccaaagatggcattact
gatatgaaactaaaggagagggcgggggctttccaatcaggaacacatcagtctcagagg
ccccctcccatgtcatcaatgattggggcatcactgtggagctcctgtgtagttttgccc
ctcctggccctcacatggatgtcggctgtcctcgccatcaccgatcggcgctctgcactc
ttccagatcctgtttgctgtgtttgattcactggaaggctttgtcattgtcatggtgcac
tgcatcctgcgacgagaggttcaggaggcagtgaagtgtcgtgtggttgaccggcaggag
gacactaatggtgattcaggaggatctttccagaatggccatgctcagctcatgactgac
tttgagaaagatgttgatatggcttgcagatcaggcactgtgaagcgctcatctctccag
ggagaggagatgtcctcctctggggccctcaccctccagaagggttctaacttcaatacc
atgccagccagcatggccaaagttcacctccagaatgtggcggactacaccagccacact
ctgacgctgcgcagggagaaaggtgccactaaaggaattagcactgagctaccgggtgcc
aaatccatctacatctgcgagggtgagctcttcaagcagctggatggagagctgcctcga
gttaatggtgagggtagctctgagggcgctgggaaaggcccggggtatctcattttacca
accaacaacacaggcaccctgaagccagccaaaggcaaagaggaacagacggccaagtac
atcgagcagctgccccagaccaggctcatccatttggctaaccctgccagtggacagcca
gtgcctggctttgggttgaataccctgcctgctgaccaggtcagtgtgtcatgctctgac
agagactcacctgcacataacctgcagaccatgcccagagactcccaggtggctaacatg
tgtgacgggggagactctggaaactccggtgtgatgtccaagagtgaaactgtctccaca
ctgtccacgagttcactggagagacgaaaatcacgctatgcagagcttgactttgagaag
ataatgcacacccggaaacgccaccaggacatgtttcaggacctgagcaggaagattcac
agtgcagacaaggatagagaatctccacctgttgatgccaaagctgccaaaagatggagt
gtgtcctctgccagcagtgacaagaccaacatgagtgacaagctacagaccccgagtaag
agggcgtgggatggcatcagaaagacccactcccccccatcctgggtgtggaggcagtgg
cagcctctcctctggagctgcacacagtggaatgacaccacagtgattggccttatctca
gaaggggatgagaccacctaccgagaggaggtaggtgttctgtggctgcaggcagtgaag
gaggaagagcaagatgctgatgaccagcagcagctgcagtcctccaccttgcacttcaca
caggctgttaccatcctactgccaaatgagctcttcaaatggcatcaactgatctgtgtc
tgtatcaacctctactacatggttcctccagatgttgcactaatacactgctacgcagcc
ccggcacttggggcccgtgaacacaaggatgggaccagtagggccagacacttcaaccat
gggtaa

DBGET integrated database retrieval system