KEGG   Monopterus albus (swamp eel): 109974049Help
Entry
109974049         CDS       T05607                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00250  Alanine, aspartate and glutamate metabolism
malb00410  beta-Alanine metabolism
malb00430  Taurine and hypotaurine metabolism
malb00650  Butanoate metabolism
malb01100  Metabolic pathways
Module
malb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109974049
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109974049
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109974049
   00430 Taurine and hypotaurine metabolism
    109974049
Enzymes [BR:malb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109974049
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 109974049
NCBI-ProteinID: XP_020479703
LinkDB All DBs
Position
Unknown
AA seq 583 aa AA seqDB search
MAASEPRATGEELDPNSANLRPPSTTYEYAWMHGCTRKLGMKICGFLQKNNNLEERTRLA
GQKSLFSLDNSDRDTRFRRTETDFSNLFARDLLPAKNGEEPTLQFLLEVVDILTNYVKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQL
STGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPGGEGDGLFSPG
GAISNMYSVMIARYKYFPEVKAKGMSAAPRLVLFTSEYSHYSIKKAGAALGFGTENVILL
STDERGRVIPADLEAKIIDAKQKGYVPLFVNATAGSTVYGAFDPIGEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQPDKQYDITYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELSQYLY
NKIKNREGYEMVFDGVPQHTNVCFWYIPPSLRGMPDGEERREKLHKVAPKIKAMMMESGT
TMVGYQPQGNKVNFFRMVISNPAATQSDIDFLIDEIERLGHDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatcggaaccgagagccaccggcgaggaactggaccccaactctgctaactta
agacctccttcaacaacttacgaatatgcgtggatgcacggatgcacgcggaaactgggg
atgaagatttgtgggttcctgcagaagaacaacaacctggaggagaggacgagactcgcg
ggacagaagagcctgttctcgctggacaacagtgacagggacacgcgcttccgccgcaca
gagaccgacttctccaacctgttcgccagagacctactgccagccaaaaatggagaggag
cctacactacagtttctgttggaggtggttgatatcctcaccaactatgtcaagaaaacc
ttcgaccgctctactaaggtgctggacttccaccaccctcaccagctcctggagggcatg
gagggtttcaacctggagctgtccgaccagcccgagtccctggagcagatcctggtggac
tgcagggacacactcaaatatggcgtccggacaggtcacccacgctttttcaaccagtta
tcaacaggtctggatatcattggtttggccggggagtggctcacttccactgctaacacc
aacatgttcacctatgagattgctccagtgtttgtactgatggagcagctgactctgaag
aaaatgagagagatgattggttggcctggcggagaaggagacggcctgttttcaccaggg
ggcgccatctccaacatgtacagtgtaatgatcgcacgttacaagtatttccccgaggtc
aaggccaagggcatgtctgctgctcctcgacttgtccttttcacctctgaatatagccac
tactccataaagaaggctggagctgctctgggctttggtacagagaatgtgattctgctg
agcacagacgagagaggcagagtaattcctgcagatctggaggccaagatcattgatgct
aaacagaagggctatgtgccattgtttgtgaatgccacagctggttcgactgtgtacggt
gcttttgaccccatcggtgagatcgccgacatctgtgagaagtacaacttgtggctccat
gttgatggagcatggggtggtggacttctgatgtccaggaagcatcgccataagcttagt
ggaattgagagggccaactctgtcacatggaacccccacaagatgatgggcgtgcctcta
cagtgctctgcaatcctagtcagagagaagggaatcctagcgggatgtaattccatgtgt
gctggctacctcttccaaccagacaaacaatatgacatcacatatgacacaggggacaaa
gccatccaatgtgggcggcacgtcgacatctttaagttctggctcatgtggaaggcaaag
ggcaccatagggtttgagcagcacattgacaggtgtctggagctgtctcagtacctgtac
aacaagatcaagaacagggagggatatgagatggtgtttgatggagtgccccagcacaca
aacgtttgtttctggtacatcccacccagcctgagaggcatgccagacggtgaagagcga
cgagaaaaactccacaaggtggcaccaaagatcaaagcaatgatgatggaatcagggacc
accatggtgggctaccagcctcagggcaataaagtcaactttttccgcatggtcatttcc
aaccctgcagctacccagtctgacatcgactttctcattgatgagattgagaggctgggt
cacgacctgtag

DBGET integrated database retrieval system