KEGG   Monopterus albus (swamp eel): 109974500Help
Entry
109974500         CDS       T05607                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb03030  DNA replication
malb03410  Base excision repair
malb03420  Nucleotide excision repair
malb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109974500 (lig1)
   03410 Base excision repair
    109974500 (lig1)
   03420 Nucleotide excision repair
    109974500 (lig1)
   03430 Mismatch repair
    109974500 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:malb03032]
    109974500 (lig1)
   03400 DNA repair and recombination proteins [BR:malb03400]
    109974500 (lig1)
Enzymes [BR:malb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109974500 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109974500 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109974500 (lig1)
DNA replication proteins [BR:malb03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109974500 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109974500 (lig1)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109974500 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     109974500 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     109974500 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C eIF-3c_N
Motif
Other DBs
NCBI-GeneID: 109974500
NCBI-ProteinID: XP_020480363
LinkDB All DBs
Position
Unknown
AA seq 997 aa AA seqDB search
MQRSIASFFQPKSKDRDTQKKTTDEPVKKSVKSPLKVQNGVQEAESPVKKVAKRCRQILD
SDDDDAPVVKEQVATKCQGDKEAPSKTEKIDEVFKAVPTPLSSPPAPATPATPASPASSA
SPGTPDSVSPSGIVKRKTARKMFPKRKLDESRSGSDSQKEEAEAKEEQGQQNKRARVETG
DDSTGEPMEEGAKEERTEKAVTETNSPDEELEKEKKEDGKEAKEEEQVDRESSDEKEKKA
EGAEKKNEAKEETDDEKGPAVAKKKVVEKDTQEGGESPKSQTLKRQKDKEPAKKAPISSF
FAPRKAAVKTEKPEKNEGEKTTDAEKKSSAEKSKDTKGDSTSGQTDYDPSRPGYHPVDHA
CWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSVLLLSPDDLLCCVYLCLNQLG
PAYLGIELGIGETVLMKAVAQTTGRHLDKIKAEAQEKGDLGLVAESSRSNQRMMFQPASL
TAEGVFRKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEARYIVRSLAGKLRIGLAEQSV
LSALGQAVCLTPPGQGFPPAVIDAGKGMSAESRRAWIEEKSLILKQTYCEMPNYDVLVPV
LLKEGIDQLPNHCKLTPGVPLRPMLAHPTKGVGEVMKKFDEAAFTCEYKYDGERAQIHIL
ESGEVRIFSRNQEDNTSKYPDIISRIPKVKKDSVVSCVLDSEAVAWDREKKQIQPFQVLT
TRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRALLRESFTEVEGEFLFARSI
DSNNTDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDL
CVIGAYLGKGKRTGTYGGFLLACYDDENEEFQSVCKIGTGFKDEDLEQHYKFLKEHILSK
PRAYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDPEKGISLRFPRFLRIR
DDKKSEDATTGAQIADLYKKQQQIQNQGEKADLEDYY
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcgtcattctttcagcccaagagtaaagacagagacactcagaag
aaaaccacagatgagccagtgaaaaaatctgtcaagagccctctgaaggtgcagaatggt
gttcaggaagcagagtcacccgtcaagaaggttgctaagcgctgccgtcaaatcctggac
agcgacgacgacgacgcgccagtcgttaaagagcaagttgctaccaagtgtcaaggagac
aaagaagcccccagtaaaacagaaaagatcgatgaagtgttcaaggctgttcctaccccc
ctgtcttcaccaccagccccagccacccctgcaaccccggccagtcctgcatcttcggct
tcaccggggacaccagactccgtctccccctctgggattgtcaaacgcaaaactgcgagg
aaaatgttcccaaagaggaagcttgacgagagcaggagtggcagcgacagtcagaaagag
gaggccgaggccaaggaggagcagggtcaacaaaacaaacgagctcgtgtggagaccggt
gacgacagcacaggtgaacccatggaggagggagcaaaggaagaaagaactgaaaaggca
gtgaccgagactaacagcccagatgaggagctggaaaaagagaagaaagaggacgggaag
gaggctaaggaggaggagcaggtggacagagagagctccgatgagaaagagaagaaagct
gagggggcggaaaagaaaaatgaagcaaaggaggagacagatgatgagaaagggcctgct
gttgccaagaagaaggtggttgaaaaggacacacaagagggaggagagagcccaaaaagt
caaacattgaaaaggcagaaagataaggagccagccaagaaagcccccatcagcagtttc
tttgctcccaggaaagctgcagtgaagacagagaaaccagagaagaatgagggagagaaa
accacagatgcagagaagaagagttcagcagagaagagtaaagacacaaaaggtgattcg
acctcagggcaaacagactacgatccgtccaggccgggctatcaccctgtggaccatgcc
tgctggaagcagggccaaaaagtgccgtacttggcggtggctcgcacttttgagaagatt
gaagaggactctggcaggctgagaaacatcgaaacgctgtcgaacctgtttcgctccgtg
ctgctgctctctccagatgacctgctgtgctgtgtgtacttgtgtctgaaccagctgggt
cctgcctatctgggaatagagctcggcattggagagactgtgctaatgaaagctgtcgct
caaacaaccgggcgacatttggacaaaatcaaggcagaggcgcaagagaaaggagatctg
ggcctagtggccgagagttcccgtagcaaccagcggatgatgttccagccggccagtctg
acagcagagggtgtgttcaggaaattgaaggaaattgccagcatgagtgggaactcggcc
atgaataagaaaatcgacatcatcaaaggcctctttgtggcgtgccgcttttctgaggcc
cgctatatagtcaggtccctggccgggaagctgaggataggcctggcagagcagagcgtc
ctgtcggcattaggccaggctgtgtgcctgaccccacctggacaaggttttcctcctgct
gtgatcgacgcagggaaagggatgagtgctgagagccggcgggcctggatcgaagagaag
agtctcattctcaaacagacttattgcgagatgcccaattacgacgtgctcgtccctgtt
ctgctaaaagaaggcatagaccagctgcccaatcactgcaagctcactccaggtgtaccg
ctgagacccatgttggctcaccccaccaagggtgtcggcgaggtgatgaaaaagtttgac
gaggcagcattcacctgcgagtacaagtacgacggagagcgtgcacagattcacattcta
gagagcggtgaggttcgaatattcagccgcaaccaggaagacaacaccagcaaataccct
gatatcatctctcgcattcccaaggtgaagaaggactctgtggtatcctgcgtcctggac
tcagaggcagttgcctgggatcgtgagaagaaacagatccagcctttccaggtcctcacc
acccgtaagagaaaggatgtggatgcctcggagatcaaagtccaagtatgtgtgtacgcc
tttgacctcctctatctcaacggcgagtccctggtgcgacagccgttgtgtcggcgtcgg
gcattgctgagagaaagcttcacagaagtggagggagagtttctgttcgcccgatccatt
gactccaacaacaccgacgccatcgcagagttcctagagcagtctgtccgagactcctgt
gagggcctgatggtgaagactctggaaaaggatgccacctatgaaattgccaagcgctct
cataactggctgaagttgaagaaggattacctggagggcgtaggtgacacagttgacctg
tgtgtgatcggtgcctacctgggaaaaggcaagaggacgggcacctatggtggcttcctg
ctggcctgctatgatgacgaaaatgaggagttccaatccgtctgcaagatcgggacaggc
ttcaaggatgaagatctggagcagcactacaagttcttaaaggagcacattctgtccaag
ccacgtgcctactaccgcgtcgaccaatcagcagagcctgatgtgtggcttgatgccgtg
caggtttgggaggtgaagtgcgccgacctgtcactgtcacctgtctacaaggctgccatg
ggaatggttgatccagagaaaggcatttctctgaggttcccccgcttccttcggatcaga
gatgacaaaaaatcagaggatgccacgaccggagcacagattgctgatttgtacaagaag
cagcagcagattcagaatcagggagaaaaagctgacctggaggactactactaa

DBGET integrated database retrieval system