KEGG   Marinovum algicola: MALG_00087Help
Entry
MALG_00087        CDS       T03981                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
malg  Marinovum algicola
Pathway
malg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:malg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MALG_00087
Enzymes [BR:malg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MALG_00087
Transporters [BR:malg02000]
 Other Transporters
  Pores ion channels [TC:1]
   MALG_00087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Tom37 GST_N_4 GST_C_3 GST_C SecA_DEAD
Motif
Other DBs
NCBI-ProteinID: AKO95304
UniProt: A0A0H4KSG1
LinkDB All DBs
Position
complement(97403..98002)
Genome map
AA seq 199 aa AA seqDB search
MYTVIGGVASRTFRVLWMLEELGADYEHRPASPHAEEVTAHSASGKIPVLLDGDAALTDS
TAILTYLADKHGALTYPAGSLERARQDAVTFAVLDELDSLLWTAARHSFVLPENQRVPAV
KESLKAEYARNLARLTDRVAGPFVMGARMTVPDIVLTHCCNWAISAKFPDPDKRLAPYLS
QMRARPAFGRARALSKPVG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtataccgtgatcggcggcgtcgccagccgcacctttcgcgtgctctggatgctcgag
gaactgggcgcggattatgaacatcggcccgccagcccgcatgccgaagaggtcacggcg
cattcagcctcgggcaagatcccggtgctgctcgacggcgatgcggcgctgaccgactcc
accgccatcctcacctatctcgccgacaaacacggcgccctcacctaccccgccggcagc
ctcgagcgcgcccggcaggatgccgtcacctttgccgtgctcgatgaattggacagcctg
ctctggaccgccgcccggcacagtttcgtcctgcccgaaaatcagcgcgtgccggccgtc
aaggaaagcctgaaggccgaatatgcccgcaatctcgcccgcctgaccgaccgcgtggcc
gggccgtttgtgatgggagcgcggatgaccgtgcccgatatcgtgctgacacactgctgc
aattgggcaatttcggcgaagttccccgacccggacaaacgacttgccccctatctgtca
caaatgcgggcgcgtccggcattcggacgcgcccgtgcattgagtaaaccggtcggctga

DBGET integrated database retrieval system